Recombinant Full Length Human EVX1 Protein, GST-tagged
Cat.No. : | EVX1-4383HF |
Product Overview : | Human EVX1 full-length ORF ( AAI52724.1 , 1 a.a. - 407 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 986 amino acids |
Description : | This gene encodes a member of the even-skipped homeobox family characterized by the presence of a homeodomain closely related to the Drosophila even-skipped (eve) segmentation gene of the pair-rule class. The encoded protein may play an important role as a transcriptional repressor during embryogenesis. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 71.17 kDa |
AA Sequence : | MESRKDMVVFLDGGQLGTLVGKRVSNLSEAVGSPLPEPPEKMVPRGCLSPRAVPPATRERGGGGPEEEPVDGLAGSAAGPGAEPQVAGAAMLGPGPPAPSVDSLSGQGQPSSSDTESDFYEEIEVSCTPDCATGNAEYQHSKGSGSEALVGSPNGGSETPKSNGGSGGGGSQGTLACSASDQMRRYRTAFTREQIARLEKEFYRENYVSRPRRCELAAALNLPETTIKVWFQNRRMKDKRQRLAMTWPHPADPAFYTYMMSHAAAAGGLPYPFPSHLPLPYYSPVGLGAASAASAAASPFSGSLRPLDTFRVLSQPYPRPELLCAFRHPPLYPGPAHGLGASAGGPCSCLACHSGPANGLAPRAAAASDFTCASTSRSDSFLTFAPSVLSKASSVALDQREEVPLTR |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | EVX1 even-skipped homeobox 1 [ Homo sapiens ] |
Official Symbol | EVX1 |
Synonyms | EVX1; even-skipped homeobox 1; eve, even skipped homeobox homolog 1 (Drosophila); homeobox even-skipped homolog protein 1; EVX-1; eve, even-skipped homeobox homolog 1; eve, even-skipped homeo box homolog 1; even-skipped homeo box 1 (homolog of Drosophila); |
Gene ID | 2128 |
mRNA Refseq | NM_001989 |
Protein Refseq | NP_001980 |
MIM | 142996 |
UniProt ID | P49640 |
◆ Recombinant Proteins | ||
EVX1-4383HF | Recombinant Full Length Human EVX1 Protein, GST-tagged | +Inquiry |
EVX1-8846Z | Recombinant Zebrafish EVX1 | +Inquiry |
EVX1-3552H | Recombinant Human EVX1 Protein, GST-tagged | +Inquiry |
EVX1-2889M | Recombinant Mouse EVX1 Protein, His (Fc)-Avi-tagged | +Inquiry |
EVX1-5362M | Recombinant Mouse EVX1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
EVX1-6515HCL | Recombinant Human EVX1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EVX1 Products
Required fields are marked with *
My Review for All EVX1 Products
Required fields are marked with *
0
Inquiry Basket