Recombinant Full Length Human EVX1 Protein, GST-tagged

• Cat.No.: EVX1-4383HF
• Product Overview: Human EVX1 full-length ORF ( AAI52724.1 , 1 a.a. - 407 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 986 amino acids
• Description: This gene encodes a member of the even-skipped homeobox family characterized by the presence of a homeodomain closely related to the Drosophila even-skipped (eve) segmentation gene of the pair-rule class. The encoded protein may play an important role as a transcriptional repressor during embryogenesis. [provided by RefSeq, Jul 2008]
• Molecular Mass: 71.17 kDa
• AA Sequence: MESRKDMVVFLDGGQLGTLVGKRVSNLSEAVGSPLPEPPEKMVPRGCLSPRAVPPATRERGGGGPEEEPVDGLAGSAAGPGAEPQVAGAAMLGPGPPAPSVDSLSGQGQPSSSDTESDFYEEIEVSCTPDCATGNAEYQHSKGSGSEALVGSPNGGSETPKSNGGSGGGGSQGTLACSASDQMRRYRTAFTREQIARLEKEFYRENYVSRPRRCELAAALNLPETTIKVWFQNRRMKDKRQRLAMTWPHPADPAFYTYMMSHAAAAGGLPYPFPSHLPLPYYSPVGLGAASAASAAASPFSGSLRPLDTFRVLSQPYPRPELLCAFRHPPLYPGPAHGLGASAGGPCSCLACHSGPANGLAPRAAAASDFTCASTSRSDSFLTFAPSVLSKASSVALDQREEVPLTR
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: EVX1 even-skipped homeobox 1 [ Homo sapiens ]
• Official Symbol: EVX1
• Synonyms: EVX1; even-skipped homeobox 1; eve, even skipped homeobox homolog 1 (Drosophila); homeobox even-skipped homolog protein 1; EVX-1; eve, even-skipped homeobox homolog 1; eve, even-skipped homeo box homolog 1; even-skipped homeo box 1 (homolog of Drosophila)
• Gene ID: 2128
• mRNA Refseq: NM_001989
• Protein Refseq: NP_001980
• MIM: 142996
• UniProt ID: P49640