Recombinant Human EVX1 Protein, GST-tagged

Cat.No. : EVX1-3552H
Product Overview : Human EVX1 full-length ORF ( AAI52724.1 , 1 a.a. - 407 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the even-skipped homeobox family characterized by the presence of a homeodomain closely related to the Drosophila even-skipped (eve) segmentation gene of the pair-rule class. The encoded protein may play an important role as a transcriptional repressor during embryogenesis. [provided by RefSeq, Jul 2008]
Molecular Mass : 71.17 kDa
AA Sequence : MESRKDMVVFLDGGQLGTLVGKRVSNLSEAVGSPLPEPPEKMVPRGCLSPRAVPPATRERGGGGPEEEPVDGLAGSAAGPGAEPQVAGAAMLGPGPPAPSVDSLSGQGQPSSSDTESDFYEEIEVSCTPDCATGNAEYQHSKGSGSEALVGSPNGGSETPKSNGGSGGGGSQGTLACSASDQMRRYRTAFTREQIARLEKEFYRENYVSRPRRCELAAALNLPETTIKVWFQNRRMKDKRQRLAMTWPHPADPAFYTYMMSHAAAAGGLPYPFPSHLPLPYYSPVGLGAASAASAAASPFSGSLRPLDTFRVLSQPYPRPELLCAFRHPPLYPGPAHGLGASAGGPCSCLACHSGPANGLAPRAAAASDFTCASTSRSDSFLTFAPSVLSKASSVALDQREEVPLTR
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name EVX1 even-skipped homeobox 1 [ Homo sapiens ]
Official Symbol EVX1
Synonyms EVX1; even-skipped homeobox 1; eve, even skipped homeobox homolog 1 (Drosophila); homeobox even-skipped homolog protein 1; EVX-1; eve, even-skipped homeobox homolog 1; eve, even-skipped homeo box homolog 1; even-skipped homeo box 1 (homolog of Drosophila);
Gene ID 2128
mRNA Refseq NM_001989
Protein Refseq NP_001980
MIM 142996
UniProt ID P49640

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EVX1 Products

Required fields are marked with *

My Review for All EVX1 Products

Required fields are marked with *

0
cart-icon
0
compare icon