Recombinant Full Length Human FABP5 Protein, GST-tagged
Cat.No. : | FABP5-4424HF |
Product Overview : | Human FABP5 full-length ORF ( AAH19385, 1 a.a. - 135 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 135 amino acids |
Description : | This gene encodes the fatty acid binding protein found in epidermal cells, and was first identified as being upregulated in psoriasis tissue. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. FABPs may play roles in fatty acid uptake, transport, and metabolism. Polymorphisms in this gene are associated with type 2 diabetes. The human genome contains many pseudogenes similar to this locus.[provided by RefSeq, Feb 2011] |
Molecular Mass : | 40.59 kDa |
AA Sequence : | MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLGEKFEETTADGRITQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVECVMNNVTCTRIYEKVE |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FABP5 fatty acid binding protein 5 (psoriasis-associated) [ Homo sapiens ] |
Official Symbol | FABP5 |
Synonyms | FABP5; fatty acid binding protein 5 (psoriasis-associated); fatty acid-binding protein, epidermal; E FABP; KFABP; PA FABP; epidermal-type fatty acid-binding protein; psoriasis-associated fatty acid-binding protein homolog; EFABP; E-FABP; PAFABP; PA-FABP; |
Gene ID | 2171 |
mRNA Refseq | NM_001444 |
Protein Refseq | NP_001435 |
MIM | 605168 |
UniProt ID | Q01469 |
◆ Recombinant Proteins | ||
FABP5-4424HF | Recombinant Full Length Human FABP5 Protein, GST-tagged | +Inquiry |
FABP5-3636H | Recombinant Human FABP5 Protein, GST-tagged | +Inquiry |
FABP5-1537R | Recombinant Rhesus monkey FABP5 Protein, His-tagged | +Inquiry |
FABP5-2188R | Recombinant Rat FABP5 Protein | +Inquiry |
FABP5-1490C | Recombinant Chicken FABP5 | +Inquiry |
◆ Cell & Tissue Lysates | ||
FABP5-6476HCL | Recombinant Human FABP5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FABP5 Products
Required fields are marked with *
My Review for All FABP5 Products
Required fields are marked with *
0
Inquiry Basket