Recombinant Human FABP5 Protein, GST-tagged
| Cat.No. : | FABP5-3636H | 
| Product Overview : | Human FABP5 full-length ORF ( AAH19385, 1 a.a. - 135 a.a.) recombinant protein with GST-tag at N-terminal. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | Wheat Germ | 
| Tag : | GST | 
| Description : | This gene encodes the fatty acid binding protein found in epidermal cells, and was first identified as being upregulated in psoriasis tissue. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. FABPs may play roles in fatty acid uptake, transport, and metabolism. Polymorphisms in this gene are associated with type 2 diabetes. The human genome contains many pseudogenes similar to this locus.[provided by RefSeq, Feb 2011] | 
| Molecular Mass : | 40.59 kDa | 
| AA Sequence : | MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLGEKFEETTADGRITQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVECVMNNVTCTRIYEKVE | 
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array | 
| Notes : | Best use within three months from the date of receipt of this protein. | 
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. | 
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. | 
| Gene Name | FABP5 fatty acid binding protein 5 (psoriasis-associated) [ Homo sapiens ] | 
| Official Symbol | FABP5 | 
| Synonyms | FABP5; fatty acid binding protein 5 (psoriasis-associated); fatty acid-binding protein, epidermal; E FABP; KFABP; PA FABP; epidermal-type fatty acid-binding protein; psoriasis-associated fatty acid-binding protein homolog; EFABP; E-FABP; PAFABP; PA-FABP; | 
| Gene ID | 2171 | 
| mRNA Refseq | NM_001444 | 
| Protein Refseq | NP_001435 | 
| MIM | 605168 | 
| UniProt ID | Q01469 | 
| ◆ Recombinant Proteins | ||
| FABP5-5426M | Recombinant Mouse FABP5 Protein | +Inquiry | 
| FABP5-4424HF | Recombinant Full Length Human FABP5 Protein, GST-tagged | +Inquiry | 
| FABP5-2928M | Recombinant Mouse FABP5 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| FABP5-1537R | Recombinant Rhesus monkey FABP5 Protein, His-tagged | +Inquiry | 
| Fabp5-1273M | Recombinant Mouse Fabp5 Protein, MYC/DDK-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| FABP5-6476HCL | Recombinant Human FABP5 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FABP5 Products
Required fields are marked with *
My Review for All FABP5 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            