Recombinant Full Length Human FAH Protein, GST-tagged
| Cat.No. : | FAH-6929HF | 
| Product Overview : | Recombinant Human full-length FAH(1 a.a. - 419 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. | 
- Specification
 - Gene Information
 - Related Products
 - Download
 
| Species : | Human | 
| Source : | In Vitro Cell Free System | 
| Tag : | GST | 
| Protein Length : | 419 amino acids | 
| Description : | This gene encodes the last enzyme in the tyrosine catabolism pathway. FAH deficiency is associated with Type 1 hereditary tyrosinemia (HT). | 
| Molecular Mass : | 72.8 kDa | 
| AA Sequence : | MSFIPVAEDSDFPIHNLPYGVFSTRGDPRPRIGVAIGDQILDLSIIKHLFTGPVLSKHQDVFNQPTLNSFMGLGQ AAWKEARVFLQNLLSVSQARLRDDTELRKCAFISQASATMHLPATIGDYTDFYSSRQHATNVGIMFRDKENALMP NWLHLPVGYHGRASSVVVSGTPIRRPMGQMKPDDSKPPVYGACKLLDMELEMAFFVGPGNRLGEPIPISKAHEHI FGMVLMNDWSARDIQKWEYVPLGPFLGKSFGTTVSPWVVPMDALMPFAVPNPKQDPRPLPYLCHDEPYTFDINLS VNLKGEGMSQAATICKSNFKYMYWTMLQQLTHHSVNGCNLRPGDLLASGTISGPEPENFGSMLELSWKGTKPIDL GNGQTRKFLLDGDEVIITGYCQGDGYRIGFGQCAGKVLPALLPS | 
| Applications : | ELISA; WB-Re; AP; Array | 
| Notes : | Best use within three months from the date of receipt of this protein. | 
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. | 
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. | 
| Gene Name | FAH fumarylacetoacetate hydrolase (fumarylacetoacetase) [ Homo sapiens (human) ] | 
| Official Symbol | FAH | 
| Synonyms | FAH; fumarylacetoacetate hydrolase (fumarylacetoacetase); fumarylacetoacetase; FAA; beta-diketonase; FLJ51912 | 
| Gene ID | 2184 | 
| mRNA Refseq | NM_000137 | 
| Protein Refseq | NP_000128 | 
| MIM | 613871 | 
| UniProt ID | P16930 | 
| ◆ Recombinant Proteins | ||
| FAH-3019H | Recombinant Human FAH Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry | 
| FAH-7111HFL | Recombinant Full Length Human FAH, Flag-tagged | +Inquiry | 
| Fah-1015M | Recombinant Mouse Fah Protein, MYC/DDK-tagged | +Inquiry | 
| FAH-1543R | Recombinant Rhesus monkey FAH Protein, His-tagged | +Inquiry | 
| FAH-85H | Recombinant Human FAH, His-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| FAH-6469HCL | Recombinant Human FAH 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
 - Q&As (0)
 
Ask a Question for All FAH Products
Required fields are marked with *
My Review for All FAH Products
Required fields are marked with *
  
        
    
      
            