Recombinant Full Length Human FAH Protein, GST-tagged
| Cat.No. : | FAH-6929HF |
| Product Overview : | Recombinant Human full-length FAH(1 a.a. - 419 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 419 amino acids |
| Description : | This gene encodes the last enzyme in the tyrosine catabolism pathway. FAH deficiency is associated with Type 1 hereditary tyrosinemia (HT). |
| Molecular Mass : | 72.8 kDa |
| AA Sequence : | MSFIPVAEDSDFPIHNLPYGVFSTRGDPRPRIGVAIGDQILDLSIIKHLFTGPVLSKHQDVFNQPTLNSFMGLGQ AAWKEARVFLQNLLSVSQARLRDDTELRKCAFISQASATMHLPATIGDYTDFYSSRQHATNVGIMFRDKENALMP NWLHLPVGYHGRASSVVVSGTPIRRPMGQMKPDDSKPPVYGACKLLDMELEMAFFVGPGNRLGEPIPISKAHEHI FGMVLMNDWSARDIQKWEYVPLGPFLGKSFGTTVSPWVVPMDALMPFAVPNPKQDPRPLPYLCHDEPYTFDINLS VNLKGEGMSQAATICKSNFKYMYWTMLQQLTHHSVNGCNLRPGDLLASGTISGPEPENFGSMLELSWKGTKPIDL GNGQTRKFLLDGDEVIITGYCQGDGYRIGFGQCAGKVLPALLPS |
| Applications : | ELISA; WB-Re; AP; Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | FAH fumarylacetoacetate hydrolase (fumarylacetoacetase) [ Homo sapiens (human) ] |
| Official Symbol | FAH |
| Synonyms | FAH; fumarylacetoacetate hydrolase (fumarylacetoacetase); fumarylacetoacetase; FAA; beta-diketonase; FLJ51912 |
| Gene ID | 2184 |
| mRNA Refseq | NM_000137 |
| Protein Refseq | NP_000128 |
| MIM | 613871 |
| UniProt ID | P16930 |
| ◆ Recombinant Proteins | ||
| FAH-1631H | Recombinant Human FAH protein, His-tagged | +Inquiry |
| FAH-1854R | Recombinant Rat FAH Protein, His (Fc)-Avi-tagged | +Inquiry |
| FAH-87H | Recombinant Human FAH, MYC/DDK-tagged | +Inquiry |
| FAH-1368R | Recombinant Rhesus Macaque FAH Protein, His (Fc)-Avi-tagged | +Inquiry |
| FAH-1543R | Recombinant Rhesus monkey FAH Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FAH-6469HCL | Recombinant Human FAH 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FAH Products
Required fields are marked with *
My Review for All FAH Products
Required fields are marked with *
