Recombinant Full Length Human FAM104B Protein, GST-tagged

Cat.No. : FAM104B-4454HF
Product Overview : Human FAM104B full-length ORF (1 a.a. - 115 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 115 amino acids
Description : FAM104B (Family With Sequence Similarity 104 Member B) is a Protein Coding gene. An important paralog of this gene is FAM104A.
Molecular Mass : 39.5 kDa
AA Sequence : MGGCPVRKRRRSGSKEGNHHSTQPKRNKRNPIFQDSQDTEFSWSDNERSSSRINIPERASGPEGNLNQIVTEPDANFPQFLHEGLSKPVYVINWFMSFGPEIKLNTSQQGRNQAV
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FAM104B family with sequence similarity 104, member B [ Homo sapiens ]
Official Symbol FAM104B
Synonyms FAM104B; family with sequence similarity 104, member B; chromosome X open reading frame 44 , CXorf44; protein FAM104B; FLJ20434; CXorf44; FLJ18375;
Gene ID 90736
mRNA Refseq NM_001166699
Protein Refseq NP_001160171
UniProt ID Q5XKR9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FAM104B Products

Required fields are marked with *

My Review for All FAM104B Products

Required fields are marked with *

0
cart-icon