Recombinant Human FAM104B Protein, GST-tagged
Cat.No. : | FAM104B-3665H |
Product Overview : | Human FAM104B full-length ORF (1 a.a. - 115 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | FAM104B (Family With Sequence Similarity 104 Member B) is a Protein Coding gene. An important paralog of this gene is FAM104A. |
Molecular Mass : | 39.5 kDa |
AA Sequence : | MGGCPVRKRRRSGSKEGNHHSTQPKRNKRNPIFQDSQDTEFSWSDNERSSSRINIPERASGPEGNLNQIVTEPDANFPQFLHEGLSKPVYVINWFMSFGPEIKLNTSQQGRNQAV |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FAM104B family with sequence similarity 104, member B [ Homo sapiens ] |
Official Symbol | FAM104B |
Synonyms | FAM104B; family with sequence similarity 104, member B; chromosome X open reading frame 44 , CXorf44; protein FAM104B; FLJ20434; CXorf44; FLJ18375; |
Gene ID | 90736 |
mRNA Refseq | NM_001166699 |
Protein Refseq | NP_001160171 |
UniProt ID | Q5XKR9 |
◆ Recombinant Proteins | ||
FAM104B-4454HF | Recombinant Full Length Human FAM104B Protein, GST-tagged | +Inquiry |
FAM104B-1139H | Recombinant Human FAM104B Protein, His-tagged | +Inquiry |
FAM104B-3665H | Recombinant Human FAM104B Protein, GST-tagged | +Inquiry |
FAM104B-1377R | Recombinant Rhesus Macaque FAM104B Protein, His (Fc)-Avi-tagged | +Inquiry |
FAM104B-1552R | Recombinant Rhesus monkey FAM104B Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FAM104B-6460HCL | Recombinant Human FAM104B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FAM104B Products
Required fields are marked with *
My Review for All FAM104B Products
Required fields are marked with *
0
Inquiry Basket