Recombinant Full Length Human FAM122C Protein, GST-tagged

Cat.No. : FAM122C-4510HF
Product Overview : Human FAM122C full-length ORF ( NP_620174.1, 1 a.a. - 152 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 152 amino acids
Description : FAM122C (Family With Sequence Similarity 122C) is a Protein Coding gene. An important paralog of this gene is FAM122A.
Molecular Mass : 43.5 kDa
AA Sequence : MAQEKMKLGFKSLPSSTTADGNILRRVNSAPLINGLGFNSQVLQADMLRIRTNRTTFRNRRSLLLPPPPFHGSISRLHQIKQEEAMDLINRETMSEWKLQSEIQISHSWEEGLKLNDNGLQKSSSLKCIDLTPVSSMASSIKKTGKSTSSYF
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FAM122C family with sequence similarity 122C [ Homo sapiens (human) ]
Official Symbol FAM122C
Synonyms FAM122C; family with sequence similarity 122C; Family With Sequence Similarity 122C; protein FAM122C
Gene ID 159091
mRNA Refseq NM_001170779
Protein Refseq NP_001164250
UniProt ID Q6P4D5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FAM122C Products

Required fields are marked with *

My Review for All FAM122C Products

Required fields are marked with *

0

Inquiry Basket

cartIcon