Recombinant Human FAM122C Protein, GST-tagged
Cat.No. : | FAM122C-3691H |
Product Overview : | Human FAM122C full-length ORF ( NP_620174.1, 1 a.a. - 152 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | FAM122C (Family With Sequence Similarity 122C) is a Protein Coding gene. An important paralog of this gene is FAM122A. |
Molecular Mass : | 43.5 kDa |
AA Sequence : | MAQEKMKLGFKSLPSSTTADGNILRRVNSAPLINGLGFNSQVLQADMLRIRTNRTTFRNRRSLLLPPPPFHGSISRLHQIKQEEAMDLINRETMSEWKLQSEIQISHSWEEGLKLNDNGLQKSSSLKCIDLTPVSSMASSIKKTGKSTSSYF |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FAM122C family with sequence similarity 122C [ Homo sapiens (human) ] |
Official Symbol | FAM122C |
Synonyms | FAM122C; family with sequence similarity 122C; Family With Sequence Similarity 122C; protein FAM122C |
Gene ID | 159091 |
mRNA Refseq | NM_001170779 |
Protein Refseq | NP_001164250 |
UniProt ID | Q6P4D5 |
◆ Recombinant Proteins | ||
FAM122C-4510HF | Recombinant Full Length Human FAM122C Protein, GST-tagged | +Inquiry |
FAM122C-3691H | Recombinant Human FAM122C Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FAM122C-6441HCL | Recombinant Human FAM122C 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FAM122C Products
Required fields are marked with *
My Review for All FAM122C Products
Required fields are marked with *