Recombinant Full Length Human FAM181A Protein, GST-tagged

• Cat.No.: FAM181A-4538HF
• Product Overview: Human FAM181A full-length ORF ( AAH09073.1, 1 a.a. - 292 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 292 amino acids
• Description: FAM181A (Family With Sequence Similarity 181 Member A) is a Protein Coding gene.
• Molecular Mass: 58.5 kDa
• AA Sequence: MASDSDVKMLLNFVNLASSDIKAALDKSAPCRRSVDHRKYLQKQLKRFSQKYSRLPRGLPGRAAEPYLKRGSEDRPRRLLLDLGPDSSPGGGGGCKEKVLRNPYREECLAKEQLPQRQHPEAAQPGQVPMRKRQLPASFWEEPRPTHSYHVGLEGGLGPREGPPYEGKKNCKGLEPLGPETTLVSMSPRALAEKEPLKMPGVSLVGRVNAWSCCPFQYHGQPIYPGPLGALPQSPVPSLGLWRKSPAFPGELAHLCKDVDGLGQKVCRPVVLKPIPTKPAVPPPIFNVFGYL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FAM181A family with sequence similarity 181, member A [ Homo sapiens ]
• Official Symbol: FAM181A
• Synonyms: C14orf152; FAM181A; family with sequence similarity 181, member A; Family With Sequence Similarity 181 Member A; Family With Sequence Similarity 181, Member A; Chromosome 14 Open Reading Frame 152; Protein FAM181A
• Gene ID: 90050
• mRNA Refseq: NM_138344
• Protein Refseq: NP_612353
• UniProt ID: Q8N9Y4