Recombinant Full Length Human FAM181A Protein, GST-tagged
Cat.No. : | FAM181A-4538HF |
Product Overview : | Human FAM181A full-length ORF ( AAH09073.1, 1 a.a. - 292 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 292 amino acids |
Description : | FAM181A (Family With Sequence Similarity 181 Member A) is a Protein Coding gene. |
Molecular Mass : | 58.5 kDa |
AA Sequence : | MASDSDVKMLLNFVNLASSDIKAALDKSAPCRRSVDHRKYLQKQLKRFSQKYSRLPRGLPGRAAEPYLKRGSEDRPRRLLLDLGPDSSPGGGGGCKEKVLRNPYREECLAKEQLPQRQHPEAAQPGQVPMRKRQLPASFWEEPRPTHSYHVGLEGGLGPREGPPYEGKKNCKGLEPLGPETTLVSMSPRALAEKEPLKMPGVSLVGRVNAWSCCPFQYHGQPIYPGPLGALPQSPVPSLGLWRKSPAFPGELAHLCKDVDGLGQKVCRPVVLKPIPTKPAVPPPIFNVFGYL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FAM181A family with sequence similarity 181, member A [ Homo sapiens ] |
Official Symbol | FAM181A |
Synonyms | C14orf152; FAM181A; family with sequence similarity 181, member A; Family With Sequence Similarity 181 Member A; Family With Sequence Similarity 181, Member A; Chromosome 14 Open Reading Frame 152; Protein FAM181A |
Gene ID | 90050 |
mRNA Refseq | NM_138344 |
Protein Refseq | NP_612353 |
UniProt ID | Q8N9Y4 |
◆ Recombinant Proteins | ||
FAM181A-2724H | Recombinant Human FAM181A protein, His-tagged | +Inquiry |
FAM181A-3725H | Recombinant Human FAM181A Protein, GST-tagged | +Inquiry |
FAM181A-2910H | Recombinant Human FAM181A Protein, His (Fc)-Avi-tagged | +Inquiry |
FAM181A-1296H | Recombinant Human FAM181A Protein, His-tagged | +Inquiry |
FAM181A-1449H | Recombinant Human FAM181A | +Inquiry |
◆ Cell & Tissue Lysates | ||
FAM181A-264HCL | Recombinant Human FAM181A lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FAM181A Products
Required fields are marked with *
My Review for All FAM181A Products
Required fields are marked with *