Recombinant Full Length Human FAM218A Protein, GST-tagged
Cat.No. : | FAM218A-3862HF |
Product Overview : | Human C4orf39 full-length ORF ( NP_694572.1, 1 a.a. - 157 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 157 amino acids |
Description : | FAM218A (Family With Sequence Similarity 218 Member A) is a Protein Coding gene. |
Molecular Mass : | 43.4 kDa |
AA Sequence : | MEGCAVRRGSCPLLPGPSAWRASPAGWAGRAKLRSWCRASGLPNRPYTLTGGRHGSVSLLRHPGTTTFVQQRSLHQSWEKRIVFSACPVSRSWCPERNFSGSIPAVTPPKLPGHSKSEGPPGKVRKRTTIRSQPLFVTRTRGFGSAVGWLPLGSPVL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FAM218A family with sequence similarity 218 member A [ Homo sapiens (human) ] |
Official Symbol | FAM218A |
Synonyms | FAM218A; family with sequence similarity 218 member A; C4orf39; protein FAM218A; uncharacterized protein C4orf39; Family With Sequence Similarity 218 Member A; Family With Sequence Similarity 218, Member A; Chromosome 4 Open Reading Frame 39; Uncharacterized Protein C4orf39; Protein FAM218A |
Gene ID | 152756 |
mRNA Refseq | NM_153027 |
Protein Refseq | NP_694572 |
UniProt ID | Q96MZ4 |
◆ Recombinant Proteins | ||
FAM218A-5227H | Recombinant Human FAM218A Protein, GST-tagged | +Inquiry |
FAM218A-3862HF | Recombinant Full Length Human FAM218A Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FAM218A Products
Required fields are marked with *
My Review for All FAM218A Products
Required fields are marked with *