Recombinant Human FAM218A Protein, GST-tagged

Cat.No. : FAM218A-5227H
Product Overview : Human C4orf39 full-length ORF ( NP_694572.1, 1 a.a. - 157 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : FAM218A (Family With Sequence Similarity 218 Member A) is a Protein Coding gene.
Molecular Mass : 43.4 kDa
AA Sequence : MEGCAVRRGSCPLLPGPSAWRASPAGWAGRAKLRSWCRASGLPNRPYTLTGGRHGSVSLLRHPGTTTFVQQRSLHQSWEKRIVFSACPVSRSWCPERNFSGSIPAVTPPKLPGHSKSEGPPGKVRKRTTIRSQPLFVTRTRGFGSAVGWLPLGSPVL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FAM218A family with sequence similarity 218 member A [ Homo sapiens (human) ]
Official Symbol FAM218A
Synonyms FAM218A; family with sequence similarity 218 member A; C4orf39; protein FAM218A; uncharacterized protein C4orf39; Family With Sequence Similarity 218 Member A; Family With Sequence Similarity 218, Member A; Chromosome 4 Open Reading Frame 39; Uncharacterized Protein C4orf39; Protein FAM218A
Gene ID 152756
mRNA Refseq NM_153027
Protein Refseq NP_694572
UniProt ID Q96MZ4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FAM218A Products

Required fields are marked with *

My Review for All FAM218A Products

Required fields are marked with *

0

Inquiry Basket

cartIcon