Recombinant Full Length Human FAM219B Protein, C-Flag-tagged
Cat.No. : | FAM219B-2179HFL |
Product Overview : | Recombinant Full Length Human FAM219B Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | FAM219B (Family With Sequence Similarity 219 Member B) is a Protein Coding gene. Diseases associated with FAM219B include Leopard Syndrome 1 and Cranioectodermal Dysplasia 1. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 20.9 kDa |
AA Sequence : | MATAEPSGRALRLSTPGPRPSGARDRAPGAAGPPSGQIGNRALRLGERTPAAVEKRGPYMVTRAPSIQAK LQKHRDLAKAVLRRKGMLGASPNRPDSSGKRSVKFNKGYTALSQSPDENLVSLDSDSDGELGSRYSSGYS SAEQVNQDVSRQLLQDGYHLDEIPDDEDLDLIPPKPMASSTCSCCWCCLGDSSSCTLQ myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Full Length : | Full L. |
Gene Name | FAM219B family with sequence similarity 219 member B [ Homo sapiens (human) ] |
Official Symbol | FAM219B |
Synonyms | C15orf17 |
Gene ID | 57184 |
mRNA Refseq | NM_020447.5 |
Protein Refseq | NP_065180.1 |
UniProt ID | Q5XKK7 |
◆ Recombinant Proteins | ||
FAM219B-2179HFL | Recombinant Full Length Human FAM219B Protein, C-Flag-tagged | +Inquiry |
Fam219b-2930M | Recombinant Mouse Fam219b Protein, Myc/DDK-tagged | +Inquiry |
FAM219B-2275Z | Recombinant Zebrafish FAM219B | +Inquiry |
FAM219B-889H | Recombinant Human FAM219B Protein, His (Fc)-Avi-tagged | +Inquiry |
FAM219B-1335H | Recombinant Human FAM219B | +Inquiry |
◆ Cell & Tissue Lysates | ||
FAM219B-8272HCL | Recombinant Human C15orf17 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FAM219B Products
Required fields are marked with *
My Review for All FAM219B Products
Required fields are marked with *