Recombinant Full Length Human FAM219B Protein, C-Flag-tagged

• Cat.No.: FAM219B-2179HFL
• Product Overview: Recombinant Full Length Human FAM219B Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Species: Human
• Source: Mammalian Cells
• Tag: Flag
• Description: FAM219B (Family With Sequence Similarity 219 Member B) is a Protein Coding gene. Diseases associated with FAM219B include Leopard Syndrome 1 and Cranioectodermal Dysplasia 1.
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Molecular Mass: 20.9 kDa
• AA Sequence: MATAEPSGRALRLSTPGPRPSGARDRAPGAAGPPSGQIGNRALRLGERTPAAVEKRGPYMVTRAPSIQAK LQKHRDLAKAVLRRKGMLGASPNRPDSSGKRSVKFNKGYTALSQSPDENLVSLDSDSDGELGSRYSSGYS SAEQVNQDVSRQLLQDGYHLDEIPDDEDLDLIPPKPMASSTCSCCWCCLGDSSSCTLQ myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Protein Families: Druggable Genome
• Full Length: Full L.

Gene Information

• Gene Name: FAM219B family with sequence similarity 219 member B [ Homo sapiens (human) ]
• Official Symbol: FAM219B
• Synonyms: C15orf17
• Gene ID: 57184
• mRNA Refseq: NM_020447.5
• Protein Refseq: NP_065180.1
• UniProt ID: Q5XKK7