Recombinant Full Length Human FAM219B Protein, C-Flag-tagged

Cat.No. : FAM219B-2179HFL
Product Overview : Recombinant Full Length Human FAM219B Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Mammalian Cells
Tag : Flag
Description : FAM219B (Family With Sequence Similarity 219 Member B) is a Protein Coding gene. Diseases associated with FAM219B include Leopard Syndrome 1 and Cranioectodermal Dysplasia 1.
Form : 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Molecular Mass : 20.9 kDa
AA Sequence : MATAEPSGRALRLSTPGPRPSGARDRAPGAAGPPSGQIGNRALRLGERTPAAVEKRGPYMVTRAPSIQAK LQKHRDLAKAVLRRKGMLGASPNRPDSSGKRSVKFNKGYTALSQSPDENLVSLDSDSDGELGSRYSSGYS SAEQVNQDVSRQLLQDGYHLDEIPDDEDLDLIPPKPMASSTCSCCWCCLGDSSSCTLQ myc-FLAG tag
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >50 ug/mL as determined by microplate BCA method.
Preparation : Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Protein Families : Druggable Genome
Full Length : Full L.
Gene Name FAM219B family with sequence similarity 219 member B [ Homo sapiens (human) ]
Official Symbol FAM219B
Synonyms C15orf17
Gene ID 57184
mRNA Refseq NM_020447.5
Protein Refseq NP_065180.1
UniProt ID Q5XKK7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FAM219B Products

Required fields are marked with *

My Review for All FAM219B Products

Required fields are marked with *

0
cart-icon