Recombinant Full Length Human FAM46D Protein, GST-tagged

Cat.No. : FAM46D-4604HF
Product Overview : Human FAM46D full-length ORF ( NP_689843.1, 1 a.a. - 389 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 389 amino acids
Description : Antibodies against the protein encoded by this gene were found only in plasma from cancer patients. While it may be a target for immunotherapy, the function of this gene is unknown. [provided by RefSeq, Dec 2009]
Molecular Mass : 70.9 kDa
AA Sequence : MSEIRFTNLTWDQVITLDQVLDEVIPIHGKGNFPTMEVKPKDIIHVVKDQLIGQGIIVKDARLNGSVASYILASHNGISYKDLDVIFGVELPGNEEFQVVKDAVLDCLLDFLPKDVKKEKLSPDIMKDAYVQKLVKVCNGHDCWSLISLSNNTGKNLELKFVSSLRRQFEFSVDSFQIVLDPMLDFYSDKNAKLTKESYPVVVAESMYGDFQEAMTHLQHKLICTRKPEEIRGGGLLKYCSLLVHGFKPACMSEIKNLERYMCSRFFIDFPHIEEQQKKIESYLHNHFIGEGMTKYDYLMTLHGVVNESTVCLMSYERRQILHLITMMALKVLGELNILPNTQKVTCFYQPAPYFAAEARYPIYVIPEPPPVSFQPYHPLHFRGSNGMS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FAM46D family with sequence similarity 46, member D [ Homo sapiens ]
Official Symbol FAM46D
Synonyms FAM46D; family with sequence similarity 46, member D; protein FAM46D; cancer/testis antigen 112; CT1.26; CT112; MGC26999;
Gene ID 169966
mRNA Refseq NM_001170574
Protein Refseq NP_001164045
MIM 300976
UniProt ID Q8NEK8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FAM46D Products

Required fields are marked with *

My Review for All FAM46D Products

Required fields are marked with *

0
cart-icon