Recombinant Human FAM46D Protein, GST-tagged
Cat.No. : | FAM46D-3768H |
Product Overview : | Human FAM46D full-length ORF ( NP_689843.1, 1 a.a. - 389 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Antibodies against the protein encoded by this gene were found only in plasma from cancer patients. While it may be a target for immunotherapy, the function of this gene is unknown. [provided by RefSeq, Dec 2009] |
Molecular Mass : | 70.9 kDa |
AA Sequence : | MSEIRFTNLTWDQVITLDQVLDEVIPIHGKGNFPTMEVKPKDIIHVVKDQLIGQGIIVKDARLNGSVASYILASHNGISYKDLDVIFGVELPGNEEFQVVKDAVLDCLLDFLPKDVKKEKLSPDIMKDAYVQKLVKVCNGHDCWSLISLSNNTGKNLELKFVSSLRRQFEFSVDSFQIVLDPMLDFYSDKNAKLTKESYPVVVAESMYGDFQEAMTHLQHKLICTRKPEEIRGGGLLKYCSLLVHGFKPACMSEIKNLERYMCSRFFIDFPHIEEQQKKIESYLHNHFIGEGMTKYDYLMTLHGVVNESTVCLMSYERRQILHLITMMALKVLGELNILPNTQKVTCFYQPAPYFAAEARYPIYVIPEPPPVSFQPYHPLHFRGSNGMS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FAM46D family with sequence similarity 46, member D [ Homo sapiens ] |
Official Symbol | FAM46D |
Synonyms | FAM46D; family with sequence similarity 46, member D; protein FAM46D; cancer/testis antigen 112; CT1.26; CT112; MGC26999; |
Gene ID | 169966 |
mRNA Refseq | NM_001170574 |
Protein Refseq | NP_001164045 |
MIM | 300976 |
UniProt ID | Q8NEK8 |
◆ Recombinant Proteins | ||
FAM46D-1436R | Recombinant Rhesus Macaque FAM46D Protein, His (Fc)-Avi-tagged | +Inquiry |
FAM46D-4604HF | Recombinant Full Length Human FAM46D Protein, GST-tagged | +Inquiry |
FAM46D-3768H | Recombinant Human FAM46D Protein, GST-tagged | +Inquiry |
FAM46D-1612R | Recombinant Rhesus monkey FAM46D Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FAM46D-265HCL | Recombinant Human FAM46D lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FAM46D Products
Required fields are marked with *
My Review for All FAM46D Products
Required fields are marked with *
0
Inquiry Basket