Recombinant Full Length Human FAM50A Protein, GST-tagged
| Cat.No. : | FAM50A-4613HF | 
| Product Overview : | Human FAM50A full-length ORF ( AAH00028, 1 a.a. - 339 a.a.) recombinant protein with GST-tag at N-terminal. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | In Vitro Cell Free System | 
| Tag : | GST | 
| Protein Length : | 339 amino acids | 
| Description : | This gene belongs to the FAM50 family. The encoded protein is highly conserved in length and sequence across different species. It is a basic protein containing a nuclear localization signal, and may function as a DNA-binding protein or a transcriptional factor. [provided by RefSeq, Sep 2009] | 
| Molecular Mass : | 63.03 kDa | 
| AA Sequence : | MAQYKGAASEAGRAMHLMKKREKQREQMEQMKQRIAEENIMKSNIDKKFSAHYDAVEAELKSSTVGLVTLNDMKAKQEALVKEREKQLAKKEQSKELQMKLEKLREKERKKEAKRKISSLSFTLEEEEEGGEEEEEAAMYEEEMEREEITTKKRKLGKNPDVDTSFLPDRDREEEENRLREELRQEWEAKQEKIKSEEIEITFSYWDGSGHRRTVKMRKGNTMQQFLQKALEILRKDFSELRSAGVEQLMYIKEDLIIPHHHSFYDFIVTKARGKSGPLFNFDVHDDVRLLSDATVEKDESHAGKVVLRSWYEKNKHIFPASRWEPYDPEKKWDKYTIR | 
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array | 
| Notes : | Best use within three months from the date of receipt of this protein. | 
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. | 
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. | 
| Gene Name | FAM50A family with sequence similarity 50, member A [ Homo sapiens ] | 
| Official Symbol | FAM50A | 
| Synonyms | FAM50A; family with sequence similarity 50, member A; protein FAM50A; 9F; DNA segment on chromosome X (unique) 9928 expressed sequence; DXS9928E; HXC 26; XAP5; protein XAP-5; HXC26; HXC-26; | 
| Gene ID | 9130 | 
| mRNA Refseq | NM_004699 | 
| Protein Refseq | NP_004690 | 
| MIM | 300453 | 
| UniProt ID | Q14320 | 
| ◆ Recombinant Proteins | ||
| FAM50A-348H | Recombinant Human FAM50A Protein, MYC/DDK-tagged | +Inquiry | 
| FAM50A-485H | Recombinant Human FAM50A Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry | 
| FAM50A-2406Z | Recombinant Zebrafish FAM50A | +Inquiry | 
| FAM50A-4613HF | Recombinant Full Length Human FAM50A Protein, GST-tagged | +Inquiry | 
| FAM50A-28823TH | Recombinant Human FAM50A, His-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| FAM50A-6371HCL | Recombinant Human FAM50A 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FAM50A Products
Required fields are marked with *
My Review for All FAM50A Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            