Recombinant Human FAM50A, His-tagged
Cat.No. : | FAM50A-28823TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 6-309 of Human FAM50A with N terminal His tag; MWt 35kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 6-309 a.a. |
Description : | This gene belongs to the FAM50 family. The encoded protein is highly conserved in length and sequence across different species. It is a basic protein containing a nuclear localization signal, and may function as a DNA-binding protein or a transcriptional factor. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 101 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | GAASEAGRAMHLMKKREKQREQMEQMKQRIAEENIMKSNI DKKFSAHYDAVEAELKSSTVGLVTLNDMKAKQEALVKE REKQLAKKEQSKELQMKLEKLREKERKKEAKRKISSLS FTLEEEEEGGEEEEEAAMYEEEMEREEITTKKRKLGKN PDVDTSFLPDRDREEEENRLREELRQEWEAKQEKIKSEEI EITFSYWDGSGHRRTVKMRKGNTMQQFLQKALEILRKD FSELRSAGVEQLMYIKEDLIIPHHHSFYDFIVTKARGK SGPLFNFDVHDDVRLLSDATVEKDESHAGKVVLR |
Gene Name | FAM50A family with sequence similarity 50, member A [ Homo sapiens ] |
Official Symbol | FAM50A |
Synonyms | FAM50A; family with sequence similarity 50, member A; protein FAM50A; 9F; DNA segment on chromosome X (unique) 9928 expressed sequence; DXS9928E; HXC 26; XAP5; |
Gene ID | 9130 |
mRNA Refseq | NM_004699 |
Protein Refseq | NP_004690 |
MIM | 300453 |
Uniprot ID | Q14320 |
Chromosome Location | Xq28 |
Function | molecular_function; |
◆ Recombinant Proteins | ||
FAM50A-3774H | Recombinant Human FAM50A Protein, GST-tagged | +Inquiry |
FAM50A-5606M | Recombinant Mouse FAM50A Protein | +Inquiry |
FAM50A-348H | Recombinant Human FAM50A Protein, MYC/DDK-tagged | +Inquiry |
FAM50A-12708H | Recombinant Human FAM50A, His-tagged | +Inquiry |
FAM50A-4613HF | Recombinant Full Length Human FAM50A Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FAM50A-6371HCL | Recombinant Human FAM50A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FAM50A Products
Required fields are marked with *
My Review for All FAM50A Products
Required fields are marked with *