Recombinant Human FAM50A Protein, GST-tagged
Cat.No. : | FAM50A-3774H |
Product Overview : | Human FAM50A full-length ORF ( AAH00028, 1 a.a. - 339 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene belongs to the FAM50 family. The encoded protein is highly conserved in length and sequence across different species. It is a basic protein containing a nuclear localization signal, and may function as a DNA-binding protein or a transcriptional factor. [provided by RefSeq, Sep 2009] |
Molecular Mass : | 63.03 kDa |
AA Sequence : | MAQYKGAASEAGRAMHLMKKREKQREQMEQMKQRIAEENIMKSNIDKKFSAHYDAVEAELKSSTVGLVTLNDMKAKQEALVKEREKQLAKKEQSKELQMKLEKLREKERKKEAKRKISSLSFTLEEEEEGGEEEEEAAMYEEEMEREEITTKKRKLGKNPDVDTSFLPDRDREEEENRLREELRQEWEAKQEKIKSEEIEITFSYWDGSGHRRTVKMRKGNTMQQFLQKALEILRKDFSELRSAGVEQLMYIKEDLIIPHHHSFYDFIVTKARGKSGPLFNFDVHDDVRLLSDATVEKDESHAGKVVLRSWYEKNKHIFPASRWEPYDPEKKWDKYTIR |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FAM50A family with sequence similarity 50, member A [ Homo sapiens ] |
Official Symbol | FAM50A |
Synonyms | FAM50A; family with sequence similarity 50, member A; protein FAM50A; 9F; DNA segment on chromosome X (unique) 9928 expressed sequence; DXS9928E; HXC 26; XAP5; protein XAP-5; HXC26; HXC-26; |
Gene ID | 9130 |
mRNA Refseq | NM_004699 |
Protein Refseq | NP_004690 |
MIM | 300453 |
UniProt ID | Q14320 |
◆ Recombinant Proteins | ||
FAM50A-3774H | Recombinant Human FAM50A Protein, GST-tagged | +Inquiry |
FAM50A-4613HF | Recombinant Full Length Human FAM50A Protein, GST-tagged | +Inquiry |
FAM50A-7608H | Recombinant Human FAM50A, His-tagged | +Inquiry |
FAM50A-348H | Recombinant Human FAM50A Protein, MYC/DDK-tagged | +Inquiry |
FAM50A-28823TH | Recombinant Human FAM50A, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FAM50A-6371HCL | Recombinant Human FAM50A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FAM50A Products
Required fields are marked with *
My Review for All FAM50A Products
Required fields are marked with *
0
Inquiry Basket