Recombinant Human FAM50A Protein, GST-tagged

• Cat.No.: FAM50A-3774H
• Product Overview: Human FAM50A full-length ORF ( AAH00028, 1 a.a. - 339 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene belongs to the FAM50 family. The encoded protein is highly conserved in length and sequence across different species. It is a basic protein containing a nuclear localization signal, and may function as a DNA-binding protein or a transcriptional factor. [provided by RefSeq, Sep 2009]
• Molecular Mass: 63.03 kDa
• AA Sequence: MAQYKGAASEAGRAMHLMKKREKQREQMEQMKQRIAEENIMKSNIDKKFSAHYDAVEAELKSSTVGLVTLNDMKAKQEALVKEREKQLAKKEQSKELQMKLEKLREKERKKEAKRKISSLSFTLEEEEEGGEEEEEAAMYEEEMEREEITTKKRKLGKNPDVDTSFLPDRDREEEENRLREELRQEWEAKQEKIKSEEIEITFSYWDGSGHRRTVKMRKGNTMQQFLQKALEILRKDFSELRSAGVEQLMYIKEDLIIPHHHSFYDFIVTKARGKSGPLFNFDVHDDVRLLSDATVEKDESHAGKVVLRSWYEKNKHIFPASRWEPYDPEKKWDKYTIR
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FAM50A family with sequence similarity 50, member A [ Homo sapiens ]
• Official Symbol: FAM50A
• Synonyms: FAM50A; family with sequence similarity 50, member A; protein FAM50A; 9F; DNA segment on chromosome X (unique) 9928 expressed sequence; DXS9928E; HXC 26; XAP5; protein XAP-5; HXC26; HXC-26
• Gene ID: 9130
• mRNA Refseq: NM_004699
• Protein Refseq: NP_004690
• MIM: 300453
• UniProt ID: Q14320