Recombinant Full Length Human FAM57B Protein, GST-tagged
Cat.No. : | FAM57B-4619HF |
Product Overview : | Human FAM57B full-length ORF (AAH07892.2, 1 a.a. - 224 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 224 amino acids |
Description : | This gene encodes a transmembrane protein, which may be a likely target of peroxisome proliferator-activated receptor gamma (PPAR-gamma). The product of the orthologous gene in mouse is related to obesity. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2016] |
Molecular Mass : | 51.04 kDa |
AA Sequence : | MASTAGYIVSTSCKHIIDDQHWLSSAYTQFAVPYFIYDIYAMFLCHWHKHQVKGHGGDDGAARAPGSTWAIARGYLHKEFLMVLHHAAMVLVCFPLSVVWRQGKGDFFLGCMLMAEVSTPFVCLGKILIQYKQQHTLLHKVNGALMLLSFLCCRVLLFPYLYWAYGRHAGLPLLAVPLAIPAHVNLGAALLLAPQLYWFFLICRGACRLFWPRSRPPPACQAQD |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FAM57B family with sequence similarity 57, member B [ Homo sapiens ] |
Official Symbol | FAM57B |
Synonyms | FP1188; FAM57B; family with sequence similarity 57, member B; Family With Sequence Similarity 57 Member B; Family With Sequence Similarity 57, Member B; Protein FAM57B |
Gene ID | 83723 |
mRNA Refseq | NM_031478 |
Protein Refseq | NP_113666 |
MIM | 615175 |
UniProt ID | Q71RH2 |
◆ Recombinant Proteins | ||
FAM57B-3781H | Recombinant Human FAM57B Protein, GST-tagged | +Inquiry |
FAM57B-1443R | Recombinant Rhesus Macaque FAM57B Protein, His (Fc)-Avi-tagged | +Inquiry |
FAM57B-4619HF | Recombinant Full Length Human FAM57B Protein, GST-tagged | +Inquiry |
FAM57B-1619R | Recombinant Rhesus monkey FAM57B Protein, His-tagged | +Inquiry |
RFL6480MF | Recombinant Full Length Mouse Protein Fam57B(Fam57B) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FAM57B-6364HCL | Recombinant Human FAM57B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FAM57B Products
Required fields are marked with *
My Review for All FAM57B Products
Required fields are marked with *
0
Inquiry Basket