Recombinant Human FAM57B Protein, GST-tagged

Cat.No. : FAM57B-3781H
Product Overview : Human FAM57B full-length ORF (AAH07892.2, 1 a.a. - 224 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a transmembrane protein, which may be a likely target of peroxisome proliferator-activated receptor gamma (PPAR-gamma). The product of the orthologous gene in mouse is related to obesity. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2016]
Molecular Mass : 51.04 kDa
AA Sequence : MASTAGYIVSTSCKHIIDDQHWLSSAYTQFAVPYFIYDIYAMFLCHWHKHQVKGHGGDDGAARAPGSTWAIARGYLHKEFLMVLHHAAMVLVCFPLSVVWRQGKGDFFLGCMLMAEVSTPFVCLGKILIQYKQQHTLLHKVNGALMLLSFLCCRVLLFPYLYWAYGRHAGLPLLAVPLAIPAHVNLGAALLLAPQLYWFFLICRGACRLFWPRSRPPPACQAQD
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FAM57B family with sequence similarity 57, member B [ Homo sapiens ]
Official Symbol FAM57B
Synonyms FP1188; FAM57B; family with sequence similarity 57, member B; Family With Sequence Similarity 57 Member B; Family With Sequence Similarity 57, Member B; Protein FAM57B
Gene ID 83723
mRNA Refseq NM_031478
Protein Refseq NP_113666
MIM 615175
UniProt ID Q71RH2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FAM57B Products

Required fields are marked with *

My Review for All FAM57B Products

Required fields are marked with *

0
cart-icon