Recombinant Full Length Human FAM60A Protein, GST-tagged

Cat.No. : FAM60A-4623HF
Product Overview : Human FAM60A full-length ORF ( NP_067061.1, 1 a.a. - 221 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 221 amino acids
Description : FAM60A (Family With Sequence Similarity 60 Member A) is a Protein Coding gene.
Molecular Mass : 51.3 kDa
AA Sequence : MFGFHKPKMYRSIEGCCICRAKSSSSRFTDSKRYEKDFQSCFGLHETRSGDICNACVLLVKRWKKLPAGSKKNWNHVVDARAGPSLKTTLKPKKVKTLSGNRIKSNQISKLQKEFKRHNSDAHSTTSSASPAQSPCYSNQSDDGSDTEMASGSNRTPVFSFLDLTYWKRQKICCGIIYKGRFGEVLIDTHLFKPCCSNKKAAAEKPEEQGPEPLPISTQEW
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FAM60A family with sequence similarity 60, member A [ Homo sapiens ]
Official Symbol FAM60A
Synonyms family with sequence similarity 60, member A; 30702; Ensembl:ENSG00000139146; protein FAM60A;tera protein homolog; L4; TERA; C12orf14
Gene ID 58516
mRNA Refseq NM_001135811
Protein Refseq NP_001129283
MIM 615027
UniProt ID Q9NP50

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FAM60A Products

Required fields are marked with *

My Review for All FAM60A Products

Required fields are marked with *

0
cart-icon
0
compare icon