Recombinant Full Length Human FAM71C Protein, GST-tagged

Cat.No. : FAM71C-4631HF
Product Overview : Human FAM71C full-length ORF ( NP_699195.1, 1 a.a. - 241 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 241 amino acids
Description : FAM71C (Family With Sequence Similarity 71 Member C) is a Protein Coding gene. An important paralog of this gene is FAM71A.
Molecular Mass : 53.9 kDa
AA Sequence : MEDCCMLPYYTAQSSPAMGMFNTSMGKLQRQLYKGEYTIFRYAPMFESDFIQISKRGEVIDVHNRARMVTMGIVRTSPCLTLPDVMLLARPAAVCDNARCGPATQKRESPPAEILELTRLLPLMFVKITIHNSVKKQLHLKLATGRSFYLQLCPPSDASEDLFVHWENLVYILRPPVEAYSDTRAILAGNTLDSSVLEEVQRSPVGYAMKFCEEKEQFRISRLHMNAEMFGSTYCDYTIEI
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FAM71C family with sequence similarity 71, member C [ Homo sapiens ]
Official Symbol FAM71C
Synonyms FAM71C; family with sequence similarity 71, member C; Family With Sequence Similarity 71 Member C; Family With Sequence Similarity 71, Member C
Gene ID 196472
mRNA Refseq NM_153364
Protein Refseq NP_699195
UniProt ID Q8NEG0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FAM71C Products

Required fields are marked with *

My Review for All FAM71C Products

Required fields are marked with *

0
cart-icon