Recombinant Full Length Human FAM71E1 Protein, GST-tagged

Cat.No. : FAM71E1-4633HF
Product Overview : Human FAM71E1 full-length ORF ( NP_612420.1, 1 a.a. - 231 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 231 amino acids
Description : FAM71E1 (Family With Sequence Similarity 71 Member E1) is a Protein Coding gene. An important paralog of this gene is FAM71A.
Molecular Mass : 52.2 kDa
AA Sequence : MGPPLWPDLQEPPPPGTSSQIRSPLLCDVIKPAPHHDVTVRVVPPPRFLPLLLRPLPSDGDIAMRRDRGPKPALGGAGEVEPGGMAASPTGRPRRLQRYLQSGEFDQFRDFPIFESNFVQVTRLGEVANEVTMGVAASSPALELPDLLLLAGPAKENGHLQLFGLFPLKFVQLFVHDKSRCQLEVKLNTSRTFYLQLRAPLKTRDREFGQWVRLLYRLRFLSASAVPFTQE
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FAM71E1 family with sequence similarity 71 member E1 [ Homo sapiens (human) ]
Official Symbol FAM71E1
Synonyms FAM71E1; family with sequence similarity 71 member E1; Family With Sequence Similarity 71 Member E1; Family With Sequence Similarity 71, Member E1; protein FAM71E1
Gene ID 112703
mRNA Refseq NM_001308429
Protein Refseq NP_001295358
MIM 619890
UniProt ID Q6IPT2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FAM71E1 Products

Required fields are marked with *

My Review for All FAM71E1 Products

Required fields are marked with *

0
cart-icon