Recombinant Human FAM71E1 Protein, GST-tagged

• Cat.No.: FAM71E1-3795H
• Product Overview: Human FAM71E1 full-length ORF ( NP_612420.1, 1 a.a. - 231 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: FAM71E1 (Family With Sequence Similarity 71 Member E1) is a Protein Coding gene. An important paralog of this gene is FAM71A.
• Molecular Mass: 52.2 kDa
• AA Sequence: MGPPLWPDLQEPPPPGTSSQIRSPLLCDVIKPAPHHDVTVRVVPPPRFLPLLLRPLPSDGDIAMRRDRGPKPALGGAGEVEPGGMAASPTGRPRRLQRYLQSGEFDQFRDFPIFESNFVQVTRLGEVANEVTMGVAASSPALELPDLLLLAGPAKENGHLQLFGLFPLKFVQLFVHDKSRCQLEVKLNTSRTFYLQLRAPLKTRDREFGQWVRLLYRLRFLSASAVPFTQE
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FAM71E1 family with sequence similarity 71 member E1 [ Homo sapiens (human) ]
• Official Symbol: FAM71E1
• Synonyms: FAM71E1; family with sequence similarity 71 member E1; Family With Sequence Similarity 71 Member E1; Family With Sequence Similarity 71, Member E1; protein FAM71E1
• Gene ID: 112703
• mRNA Refseq: NM_001308429
• Protein Refseq: NP_001295358
• UniProt ID: Q6IPT2