Recombinant Human FAM71E1 Protein, GST-tagged
| Cat.No. : | FAM71E1-3795H |
| Product Overview : | Human FAM71E1 full-length ORF ( NP_612420.1, 1 a.a. - 231 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | FAM71E1 (Family With Sequence Similarity 71 Member E1) is a Protein Coding gene. An important paralog of this gene is FAM71A. |
| Molecular Mass : | 52.2 kDa |
| AA Sequence : | MGPPLWPDLQEPPPPGTSSQIRSPLLCDVIKPAPHHDVTVRVVPPPRFLPLLLRPLPSDGDIAMRRDRGPKPALGGAGEVEPGGMAASPTGRPRRLQRYLQSGEFDQFRDFPIFESNFVQVTRLGEVANEVTMGVAASSPALELPDLLLLAGPAKENGHLQLFGLFPLKFVQLFVHDKSRCQLEVKLNTSRTFYLQLRAPLKTRDREFGQWVRLLYRLRFLSASAVPFTQE |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | FAM71E1 family with sequence similarity 71 member E1 [ Homo sapiens (human) ] |
| Official Symbol | FAM71E1 |
| Synonyms | FAM71E1; family with sequence similarity 71 member E1; Family With Sequence Similarity 71 Member E1; Family With Sequence Similarity 71, Member E1; protein FAM71E1 |
| Gene ID | 112703 |
| mRNA Refseq | NM_001308429 |
| Protein Refseq | NP_001295358 |
| UniProt ID | Q6IPT2 |
| ◆ Recombinant Proteins | ||
| FAM71E1-5633M | Recombinant Mouse FAM71E1 Protein | +Inquiry |
| FAM71E1-3085M | Recombinant Mouse FAM71E1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| FAM71E1-3795H | Recombinant Human FAM71E1 Protein, GST-tagged | +Inquiry |
| FAM71E1-4633HF | Recombinant Full Length Human FAM71E1 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FAM71E1-6354HCL | Recombinant Human FAM71E1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FAM71E1 Products
Required fields are marked with *
My Review for All FAM71E1 Products
Required fields are marked with *
