Recombinant Full Length Human FAM71E2 Protein, GST-tagged
| Cat.No. : | FAM71E2-4634HF |
| Product Overview : | Human FAM71E2 full-length ORF (1 a.a. - 567 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 567 amino acids |
| Description : | FAM71E2 (Family With Sequence Similarity 71 Member E2) is a Protein Coding gene. An important paralog of this gene is ENSG00000267706. |
| Molecular Mass : | 86.5 kDa |
| AA Sequence : | MDSGGSTLSSAASGLAPYPPAACLSTPYSSIPRGREKAGPMGSHQGPGPPPCQKAPSGPVTSCKAPFLVDQSQKLPAVPASSWKPPPGLAPPQKAPAASAPPRKAPAVPAPSQKAPAVPAPSQKAPAIPAPSRKASAASASPRKASAVPAPPQKTPPPSQKAPSVPTIPQKAVSPTAPKKKSLLLPAPSQKALPTSPTQYQMALSPPASRGKLPGDFDVLPTGIPGRAVLERSQSGGKPEPVVTVRTQETDVVEMTTQAKSPESPFTVTKKESKDILISQTEEVTLEAFRGQGKLEDWAHWAKLEERSPDLPGVRSKELEQRKRWVKAKELAVEGPSQEHSRPFSVEALTLTKLMITANSKEQRSKSALVSLPSWLLATPQASATSMMASVPSRPGQLSLLEGKPVVVREQPESHTWVKEGKRPWGEMKEPPWDPKGPPKVPFRSKPTSASLKREGISQAPIPLTASPWEDLRPSPLSETLISKMEATARASQQPKRVSQEPMRTPAQHPLATVGSSSEILLPMLLGLETVRNTATKAEEIQEESGVLNLLPSLQHSQHSEWPDAGA |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | FAM71E2 family with sequence similarity 71 member E2 [ Homo sapiens (human) ] |
| Official Symbol | FAM71E2 |
| Synonyms | Family With Sequence Similarity 71 Member E2; C19orf16; Family With Sequence Similarity 71, Member E2; Chromosome 19 Open Reading Frame 16; Putative Protein FAM71E2; Protein FAM71E2; protein FAM71E2; putative protein FAM71E2 |
| Gene ID | 284418 |
| mRNA Refseq | NM_001145402 |
| Protein Refseq | NP_001138874 |
| UniProt ID | Q8N5Q1 |
| ◆ Recombinant Proteins | ||
| FAM71E2-4634HF | Recombinant Full Length Human FAM71E2 Protein, GST-tagged | +Inquiry |
| FAM71E2-3796H | Recombinant Human FAM71E2 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FAM71E2 Products
Required fields are marked with *
My Review for All FAM71E2 Products
Required fields are marked with *
