Recombinant Human FAM71E2 Protein, GST-tagged

Cat.No. : FAM71E2-3796H
Product Overview : Human FAM71E2 full-length ORF (1 a.a. - 567 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : FAM71E2 (Family With Sequence Similarity 71 Member E2) is a Protein Coding gene. An important paralog of this gene is ENSG00000267706.
Molecular Mass : 86.5 kDa
AA Sequence : MDSGGSTLSSAASGLAPYPPAACLSTPYSSIPRGREKAGPMGSHQGPGPPPCQKAPSGPVTSCKAPFLVDQSQKLPAVPASSWKPPPGLAPPQKAPAASAPPRKAPAVPAPSQKAPAVPAPSQKAPAIPAPSRKASAASASPRKASAVPAPPQKTPPPSQKAPSVPTIPQKAVSPTAPKKKSLLLPAPSQKALPTSPTQYQMALSPPASRGKLPGDFDVLPTGIPGRAVLERSQSGGKPEPVVTVRTQETDVVEMTTQAKSPESPFTVTKKESKDILISQTEEVTLEAFRGQGKLEDWAHWAKLEERSPDLPGVRSKELEQRKRWVKAKELAVEGPSQEHSRPFSVEALTLTKLMITANSKEQRSKSALVSLPSWLLATPQASATSMMASVPSRPGQLSLLEGKPVVVREQPESHTWVKEGKRPWGEMKEPPWDPKGPPKVPFRSKPTSASLKREGISQAPIPLTASPWEDLRPSPLSETLISKMEATARASQQPKRVSQEPMRTPAQHPLATVGSSSEILLPMLLGLETVRNTATKAEEIQEESGVLNLLPSLQHSQHSEWPDAGA
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FAM71E2 family with sequence similarity 71 member E2 [ Homo sapiens (human) ]
Official Symbol FAM71E2
Synonyms Family With Sequence Similarity 71 Member E2; C19orf16; Family With Sequence Similarity 71, Member E2; Chromosome 19 Open Reading Frame 16; Putative Protein FAM71E2; Protein FAM71E2; protein FAM71E2; putative protein FAM71E2
Gene ID 284418
mRNA Refseq NM_001145402
Protein Refseq NP_001138874
UniProt ID Q8N5Q1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FAM71E2 Products

Required fields are marked with *

My Review for All FAM71E2 Products

Required fields are marked with *

0
cart-icon
0
compare icon