Recombinant Full Length Human FAM86C1 Protein, GST-tagged

Cat.No. : FAM86C1-4650HF
Product Overview : Human FAM86C1 full-length ORF ( ADZ15696.1, 1 a.a. - 131 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 131 amino acids
Description : FAM86C1 (Family With Sequence Similarity 86 Member C1) is a Protein Coding gene. GO annotations related to this gene include methyltransferase activity. An important paralog of this gene is EEF2KMT.
Molecular Mass : 14.5 kDa
AA Sequence : MAPEENAGSELLLQSFKRRFLAARALRSFRWQSLEAKLRDSSDSELLRDILQKTCCIAQKPSCRWSGSCGGWLPAGSTSGLLNSTWPLPSATQRCASCSPPSYAGLGSDGKRKLIMTRNCFPTESTWRWQS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FAM86C1 family with sequence similarity 86 member C1 [ Homo sapiens (human) ]
Official Symbol FAM86C1
Synonyms FAM86C1; family with sequence similarity 86 member C1; Family With Sequence Similarity 86 Member C1; Family With Sequence Similarity 86, Member C; FAM86C; Family With Sequence Similarity 86, Member C1; Protein FAM86C1; Protein FAM86C; EC 2.1.1.-; protein FAM86C1; family with sequence similarity 86, member C
Gene ID 55199
mRNA Refseq NM_001099653
Protein Refseq NP_001093123
MIM 616124
UniProt ID Q9NVL1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FAM86C1 Products

Required fields are marked with *

My Review for All FAM86C1 Products

Required fields are marked with *

0
cart-icon