Recombinant Human FAM86C1 Protein, GST-tagged
| Cat.No. : | FAM86C1-3811H |
| Product Overview : | Human FAM86C1 full-length ORF ( ADZ15696.1, 1 a.a. - 131 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | FAM86C1 (Family With Sequence Similarity 86 Member C1) is a Protein Coding gene. GO annotations related to this gene include methyltransferase activity. An important paralog of this gene is EEF2KMT. |
| Molecular Mass : | 14.5 kDa |
| AA Sequence : | MAPEENAGSELLLQSFKRRFLAARALRSFRWQSLEAKLRDSSDSELLRDILQKTCCIAQKPSCRWSGSCGGWLPAGSTSGLLNSTWPLPSATQRCASCSPPSYAGLGSDGKRKLIMTRNCFPTESTWRWQS |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | FAM86C1 family with sequence similarity 86 member C1 [ Homo sapiens (human) ] |
| Official Symbol | FAM86C1 |
| Synonyms | FAM86C1; family with sequence similarity 86 member C1; Family With Sequence Similarity 86 Member C1; Family With Sequence Similarity 86, Member C; FAM86C; Family With Sequence Similarity 86, Member C1; Protein FAM86C1; Protein FAM86C; EC 2.1.1.-; protein FAM86C1; family with sequence similarity 86, member C |
| Gene ID | 55199 |
| mRNA Refseq | NM_001099653 |
| Protein Refseq | NP_001093123 |
| MIM | 616124 |
| UniProt ID | Q9NVL1 |
| ◆ Recombinant Proteins | ||
| FAM86C1-3811H | Recombinant Human FAM86C1 Protein, GST-tagged | +Inquiry |
| FAM86C1-4650HF | Recombinant Full Length Human FAM86C1 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FAM86C1 Products
Required fields are marked with *
My Review for All FAM86C1 Products
Required fields are marked with *
