Recombinant Human FAM86C1 Protein, GST-tagged

• Cat.No.: FAM86C1-3811H
• Product Overview: Human FAM86C1 full-length ORF ( ADZ15696.1, 1 a.a. - 131 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: FAM86C1 (Family With Sequence Similarity 86 Member C1) is a Protein Coding gene. GO annotations related to this gene include methyltransferase activity. An important paralog of this gene is EEF2KMT.
• Molecular Mass: 14.5 kDa
• AA Sequence: MAPEENAGSELLLQSFKRRFLAARALRSFRWQSLEAKLRDSSDSELLRDILQKTCCIAQKPSCRWSGSCGGWLPAGSTSGLLNSTWPLPSATQRCASCSPPSYAGLGSDGKRKLIMTRNCFPTESTWRWQS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FAM86C1 family with sequence similarity 86 member C1 [ Homo sapiens (human) ]
• Official Symbol: FAM86C1
• Synonyms: FAM86C1; family with sequence similarity 86 member C1; Family With Sequence Similarity 86 Member C1; Family With Sequence Similarity 86, Member C; FAM86C; Family With Sequence Similarity 86, Member C1; Protein FAM86C1; Protein FAM86C; EC 2.1.1.-; protein FAM86C1; family with sequence similarity 86, member C
• Gene ID: 55199
• mRNA Refseq: NM_001099653
• Protein Refseq: NP_001093123
• MIM: 616124
• UniProt ID: Q9NVL1