Recombinant Full Length Human FANCD2OS Protein, GST-tagged

Cat.No. : FANCD2OS-2613HF
Product Overview : Human FANCD2OS full-length ORF (NP_775743.1, 1 a.a. - 177 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 177 amino acids
Description : This gene encodes a conserved protein of unknown function. [provided by RefSeq, Jan 2013]
Molecular Mass : 46.6 kDa
AA Sequence : MAGYQLWSPWTPLDESFQWLRHTTPTPSSKHPFKASPCFPHTPSDLEVQLCFQEVTLVLDSPFLESGVSPKLPCHTSELRTMNNKGLVRKPQPIRLSGVDSVFGRVITAQPPKWTGTFRVSDKSAFCKIISREHQWPIGLKEPQIQMTVTMCKQMLRSILLLYATYKKCTFALQHSK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FANCD2OS FANCD2 opposite strand [ Homo sapiens (human) ]
Official Symbol FANCD2OS
Synonyms FANCD2OS; FANCD2 opposite strand; C3ORF24; chromosome 3 open reading frame 24; uncharacterized protein C3orf24; MGC40179;
Gene ID 115795
mRNA Refseq NM_001164839
Protein Refseq NP_001158311
UniProt ID Q96PS1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FANCD2OS Products

Required fields are marked with *

My Review for All FANCD2OS Products

Required fields are marked with *

0
cart-icon