Recombinant Human FANCD2OS Protein, GST-Tagged

• Cat.No.: FANCD2OS-0020H
• Product Overview: Human FANCD2OS full-length ORF (NP_775743.1, 1 a.a. - 177 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a conserved protein of unknown function. [provided by RefSeq, Jan 2013]
• Molecular Mass: 46.6 kDa
• AA Sequence: MAGYQLWSPWTPLDESFQWLRHTTPTPSSKHPFKASPCFPHTPSDLEVQLCFQEVTLVLDSPFLESGVSPKLPCHTSELRTMNNKGLVRKPQPIRLSGVDSVFGRVITAQPPKWTGTFRVSDKSAFCKIISREHQWPIGLKEPQIQMTVTMCKQMLRSILLLYATYKKCTFALQHSK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FANCD2OS FANCD2 opposite strand [ Homo sapiens (human) ]
• Official Symbol: FANCD2OS
• Synonyms: FANCD2OS; FANCD2 opposite strand; C3ORF24; chromosome 3 open reading frame 24; uncharacterized protein C3orf24; MGC40179
• Gene ID: 115795
• mRNA Refseq: NM_001164839
• Protein Refseq: NP_001158311
• UniProt ID: Q96PS1