Recombinant Human FANCD2OS Protein, GST-Tagged
Cat.No. : | FANCD2OS-0020H |
Product Overview : | Human FANCD2OS full-length ORF (NP_775743.1, 1 a.a. - 177 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a conserved protein of unknown function. [provided by RefSeq, Jan 2013] |
Molecular Mass : | 46.6 kDa |
AA Sequence : | MAGYQLWSPWTPLDESFQWLRHTTPTPSSKHPFKASPCFPHTPSDLEVQLCFQEVTLVLDSPFLESGVSPKLPCHTSELRTMNNKGLVRKPQPIRLSGVDSVFGRVITAQPPKWTGTFRVSDKSAFCKIISREHQWPIGLKEPQIQMTVTMCKQMLRSILLLYATYKKCTFALQHSK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FANCD2OS FANCD2 opposite strand [ Homo sapiens (human) ] |
Official Symbol | FANCD2OS |
Synonyms | FANCD2OS; FANCD2 opposite strand; C3ORF24; chromosome 3 open reading frame 24; uncharacterized protein C3orf24; MGC40179; |
Gene ID | 115795 |
mRNA Refseq | NM_001164839 |
Protein Refseq | NP_001158311 |
UniProt ID | Q96PS1 |
◆ Recombinant Proteins | ||
FANCD2OS-0020H | Recombinant Human FANCD2OS Protein, GST-Tagged | +Inquiry |
FANCD2OS-2613HF | Recombinant Full Length Human FANCD2OS Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FANCD2OS-113HCL | Recombinant Human FANCD2OS lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FANCD2OS Products
Required fields are marked with *
My Review for All FANCD2OS Products
Required fields are marked with *