Recombinant Full Length Human FANCL Protein, GST-tagged
Cat.No. : | FANCL-4668HF |
Product Overview : | Human FANCL full-length ORF ( AAH54517, 1 a.a. - 375 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 375 amino acids |
Description : | The Fanconi anemia complementation group (FANC) currently includes FANCA, FANCB, FANCC, FANCD1 (also called BRCA2), FANCD2, FANCE, FANCF, FANCG, FANCI, FANCJ (also called BRIP1), FANCL, FANCM and FANCN (also called PALB2). The previously defined group FANCH is the same as FANCA. Fanconi anemia is a genetically heterogeneous recessive disorder characterized by cytogenetic instability, hypersensitivity to DNA crosslinking agents, increased chromosomal breakage, and defective DNA repair. The members of the Fanconi anemia complementation group do not share sequence similarity; they are related by their assembly into a common nuclear protein complex. This gene encodes the protein for complementation group L. Alternative splicing results in two transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 66.99 kDa |
AA Sequence : | MAVTEASLLRQCPLLLPQNRSKTVYEGFISAQGRDFHLRIVLPEDLQLKNARLLCSWQLRTILSGYHRIVQQRMQHSPDLMSFMMELKMLLEVALKNRQELYALPPPPQFYSSLIEEIGTLGWDKLVYADTCFSTIKLKAEDASGREHLITLKLKAKYPAESPDYFVDFPVPFCASWTPQSSLISIYSQFLAAIESLKAFWDVMDEIDEKTWVLEPEKPPRSATARRIALGNNVSINIEVDPRHPTMLPECFFLGADRVVKPLGIKLSRNIHLWDPENSVLQNLKDVLEIDFPARAILEKSDFTMDCGICYAYQLDGTIPDQVCDNSQCGQPFHQICLYEWLRGLLTSRQSFNVIFGECPYCSKPITLKMSGRKH |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FANCL Fanconi anemia, complementation group L [ Homo sapiens ] |
Official Symbol | FANCL |
Synonyms | FANCL; Fanconi anemia, complementation group L; PHD finger protein 9 , PHF9; E3 ubiquitin-protein ligase FANCL; FAAP43; FLJ10335; Pog; PHD finger protein 9; fanconi anemia group L protein; fanconi anemia-associated polypeptide of 43 kDa; POG; PHF9; |
Gene ID | 55120 |
mRNA Refseq | NM_001114636 |
Protein Refseq | NP_001108108 |
MIM | 608111 |
UniProt ID | Q9NW38 |
◆ Recombinant Proteins | ||
FANCL-3834H | Recombinant Human FANCL Protein, GST-tagged | +Inquiry |
FANCL-3270C | Recombinant Chicken FANCL | +Inquiry |
FANCL-191H | Recombinant Human FANCL, GST-tagged | +Inquiry |
FANCL-12228Z | Recombinant Zebrafish FANCL | +Inquiry |
FANCL-4668HF | Recombinant Full Length Human FANCL Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FANCL-6330HCL | Recombinant Human FANCL 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FANCL Products
Required fields are marked with *
My Review for All FANCL Products
Required fields are marked with *