Recombinant Full Length Human FASLG Protein
| Cat.No. : | FASLG-4859HF |
| Product Overview : | Human FASLG full-length ORF (AAH17502.1) recombinant protein without tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Protein Length : | 142 amino acids |
| Description : | This gene is a member of the tumor necrosis factor superfamily. The primary function of the encoded transmembrane protein is the induction of apoptosis triggered by binding to FAS. The FAS/FASLG signaling pathway is essential for immune system regulation, including activation-induced cell death (AICD) of T cells and cytotoxic T lymphocyte induced cell death. It has also been implicated in the progression of several cancers. Defects in this gene may be related to some cases of systemic lupus erythematosus (SLE). Alternatively spliced transcript variants have been described. [provided by RefSeq, Nov 2014] |
| Form : | Liquid |
| Molecular Mass : | 31.5 kDa |
| AA Sequence : | MQQPFNYPYPQIYWVDSSASSPWAPPGTVLPCPTSVPRRPGQRRPPPPPPPPPLPPPPPPPPLPPLPLPPLKKRGNHSTGLCLLVMFFMVLVALVGLGLGMFQLFHLQKELAELRESTSQMHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL |
| Applications : | Antibody Production Functional Study Compound Screening |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 25 mM Tris-HCl of pH 8.0 containing 2% glycerol. |
| Gene Name | FASLG Fas ligand [ Homo sapiens (human) ] |
| Official Symbol | FASLG |
| Synonyms | FASLG; Fas ligand (TNF superfamily, member 6); APT1LG1, TNFSF6, tumor necrosis factor (ligand) superfamily, member 6; tumor necrosis factor ligand superfamily member 6; CD178; FasL; APTL; CD95 ligand; fas antigen ligand; apoptosis antigen ligand; apoptosis (APO-1) antigen ligand 1; tumor necrosis factor (ligand) superfamily, member 6; FASL; CD95L; CD95-L; TNFSF6; APT1LG1; |
| Gene ID | 356 |
| mRNA Refseq | NM_000639 |
| Protein Refseq | NP_000630 |
| MIM | 134638 |
| UniProt ID | P48023 |
| ◆ Cell & Tissue Lysates | ||
| FASLG-6324HCL | Recombinant Human FASLG 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FASLG Products
Required fields are marked with *
My Review for All FASLG Products
Required fields are marked with *



