Recombinant Human FASLG Protein (103-281 aa), His-tagged
Cat.No. : | FASLG-1394H |
Product Overview : | Recombinant Human FASLG Protein (103-281 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Apoptosis. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 103-281 aa |
Description : | Cytokine that binds to TNFRSF6/FAS, a receptor that transduces the apoptotic signal into cells. May be involved in cytotoxic T-cell mediated apoptosis and in T-cell development. TNFRSF6/FAS-mediated apoptosis may have a role in the induction of peripheral tolerance, in the antigen-stimulated suicide of mature T-cells, or both. Binding to the decoy receptor TNFRSF6B/DcR3 modulates its effects. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 22.4 kDa |
AA Sequence : | QLFHLQKELAELRESTSQMHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | FASLG Fas ligand (TNF superfamily, member 6) [ Homo sapiens ] |
Official Symbol | FASLG |
Synonyms | FASLG; CD178; FasL; APTL; CD95 ligand; FASL; CD95L; CD95-L; TNFSF6; APT1LG1; |
Gene ID | 356 |
mRNA Refseq | NM_000639 |
Protein Refseq | NP_000630 |
MIM | 134638 |
UniProt ID | P48023 |
◆ Recombinant Proteins | ||
FASLG-2180P | Recombinant Pig FASLG Protein, His&SUMO-tagged | +Inquiry |
FASLG-1616H | Recombinant Human Fas ligand (TNF superfamily, member 6) | +Inquiry |
FASLG-4272H | Recombinant Human FASLG Protein (Pro134-Leu281), C-His tagged | +Inquiry |
Fasl-482M | Active Recombinant Mouse Fasl protein, HA-tagged | +Inquiry |
FASLG-244H | Recombinant Human FASLG Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FASLG-6324HCL | Recombinant Human FASLG 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FASLG Products
Required fields are marked with *
My Review for All FASLG Products
Required fields are marked with *