Recombinant Human FASLG Protein (103-281 aa), His-tagged

Cat.No. : FASLG-1394H
Product Overview : Recombinant Human FASLG Protein (103-281 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Apoptosis. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Yeast
Tag : His
Protein Length : 103-281 aa
Description : Cytokine that binds to TNFRSF6/FAS, a receptor that transduces the apoptotic signal into cells. May be involved in cytotoxic T-cell mediated apoptosis and in T-cell development. TNFRSF6/FAS-mediated apoptosis may have a role in the induction of peripheral tolerance, in the antigen-stimulated suicide of mature T-cells, or both. Binding to the decoy receptor TNFRSF6B/DcR3 modulates its effects.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 22.4 kDa
AA Sequence : QLFHLQKELAELRESTSQMHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products.
Gene Name FASLG Fas ligand (TNF superfamily, member 6) [ Homo sapiens ]
Official Symbol FASLG
Synonyms FASLG; CD178; FasL; APTL; CD95 ligand; FASL; CD95L; CD95-L; TNFSF6; APT1LG1;
Gene ID 356
mRNA Refseq NM_000639
Protein Refseq NP_000630
MIM 134638
UniProt ID P48023

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FASLG Products

Required fields are marked with *

My Review for All FASLG Products

Required fields are marked with *

0

Inquiry Basket

cartIcon