Recombinant Full Length Human FASLG Protein, GST-tagged
| Cat.No. : | FASLG-4861HF |
| Product Overview : | Human FASLG full-length ORF ( AAH17502.1, 1 a.a. - 281 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 281 amino acids |
| Description : | This gene is a member of the tumor necrosis factor superfamily. The primary function of the encoded transmembrane protein is the induction of apoptosis triggered by binding to FAS. The FAS/FASLG signaling pathway is essential for immune system regulation, including activation-induced cell death (AICD) of T cells and cytotoxic T lymphocyte induced cell death. It has also been implicated in the progression of several cancers. Defects in this gene may be related to some cases of systemic lupus erythematosus (SLE). Alternatively spliced transcript variants have been described. [provided by RefSeq, Nov 2014] |
| Molecular Mass : | 56.65 kDa |
| AA Sequence : | MQQPFNYPYPQIYWVDSSASSPWAPPGTVLPCPTSVPRRPGQRRPPPPPPPPPLPPPPPPPPLPPLPLPPLKKRGNHSTGLCLLVMFFMVLVALVGLGLGMFQLFHLQKELAELRESTSQMHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | FASLG Fas ligand (TNF superfamily, member 6) [ Homo sapiens ] |
| Official Symbol | FASLG |
| Synonyms | FASLG; Fas ligand (TNF superfamily, member 6); APT1LG1, TNFSF6, tumor necrosis factor (ligand) superfamily, member 6; tumor necrosis factor ligand superfamily member 6; CD178; FasL; APTL; CD95 ligand; fas antigen ligand; apoptosis antigen ligand; apoptosis (APO-1) antigen ligand 1; tumor necrosis factor (ligand) superfamily, member 6; FASL; CD95L; CD95-L; TNFSF6; APT1LG1; |
| Gene ID | 356 |
| mRNA Refseq | NM_000639 |
| Protein Refseq | NP_000630 |
| MIM | 134638 |
| UniProt ID | P48023 |
| ◆ Recombinant Proteins | ||
| FASLG-065H | Recombinant Human FASLG Protein, C-His-tagged | +Inquiry |
| FASLG-2884H | Recombinant Human FASLG protein, His-tagged | +Inquiry |
| FASLG-3825Z | Recombinant Zebrafish FASLG | +Inquiry |
| FASLG-1469R | Recombinant Rhesus Macaque FASLG Protein, His (Fc)-Avi-tagged | +Inquiry |
| FASLG-2180P | Recombinant Pig FASLG Protein, His&SUMO-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FASLG-6324HCL | Recombinant Human FASLG 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FASLG Products
Required fields are marked with *
My Review for All FASLG Products
Required fields are marked with *
