Recombinant Full Length Human FBLN7 Protein, GST-tagged
| Cat.No. : | FBLN7-4895HF |
| Product Overview : | Human FBLN7 full-length ORF (BAC04416.1, 1 a.a. - 439 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 439 amino acids |
| Description : | FBLN7 (Fibulin 7) is a Protein Coding gene. GO annotations related to this gene include calcium ion binding and heparin binding. |
| Molecular Mass : | 73.8 kDa |
| AA Sequence : | MVPSSPRALFLLLLILACPEPRASQNCLSKQQLLSAIRQLQQLLKGQETRFAEGIRHMKSRLAALQNSVGRVGPDALPVSCPALNTPADGRKFGSKYLVDHEVHFTCNPGFRLVGPSSMVCLPNGTWTGEQPHCRGISECSSQPCQNGGTCVEGVNQYRCICPPGRTGNRCQHQAQTAAPEGSVAGDSAFSRAPRCAQVERAQHCSCEAGFHLSGAAGDSVCQDVNECELYGQEGRPRLCMHACVNTPGSYRCTCPGGYRTLADGKSCEDVDECVGLQPVCPQGTTCINTGGSFQCVSPECPEGSGNVSYVKTPPFQCERNPCPMDSRPCRHLPKTISFHYLSLPSNLKTPITLFRMATASAPGRAGPNSLRFGIVGGNSRGHFVMQRSDRQTGDLILVQNLEGPQTLEVDVDMSEYLDRSFQANHVSKVTIFVSPYDF |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | FBLN7 fibulin 7 [ Homo sapiens ] |
| Official Symbol | FBLN7 |
| Synonyms | TM14; FBLN7; fibulin 7; FBLN7; Fibulin 7; FIBL-7; TM14; Fibulin-7 |
| Gene ID | 129804 |
| mRNA Refseq | NM_153214 |
| Protein Refseq | NP_694946 |
| MIM | 611551 |
| UniProt ID | Q53RD9 |
| ◆ Recombinant Proteins | ||
| Fbln7-227M | Recombinant Mouse Fbln7 Protein, His-tagged | +Inquiry |
| Fbln7-228R | Recombinant Rat Fbln7 Protein, His-tagged | +Inquiry |
| FBLN7-4895HF | Recombinant Full Length Human FBLN7 Protein, GST-tagged | +Inquiry |
| FBLN7-1727H | Recombinant Human FBLN7 protein, His & T7-tagged | +Inquiry |
| FBLN7-3877H | Recombinant Human FBLN7 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FBLN7 Products
Required fields are marked with *
My Review for All FBLN7 Products
Required fields are marked with *
