Recombinant Full Length Human FCER1G Protein, GST-tagged
| Cat.No. : | FCER1G-6927HF |
| Product Overview : | Recombinant Human full-length FCER1G(1 a.a. - 86 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 86 amino acids |
| Description : | The high affinity IgE receptor is a key molecule involved in allergic reactions. It is a tetramer composed of 1 alpha, 1 beta, and 2 gamma chains. The gamma chains are also subunits of other Fc receptors. |
| Molecular Mass : | 36.1 kDa |
| AA Sequence : | MIPAVVLLLLLLVEQAAALGEPQLCYILDAILFLYGIVLTLLYCRLKIQVRKAAITSYEKSDGVYTGLSTRNQET YETLKHEKPPQ |
| Applications : | ELISA; WB-Re; AP; Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | FCER1G Fc epsilon receptor Ig [ Homo sapiens (human) ] |
| Official Symbol | FCER1G |
| Synonyms | FCER1G; Fc fragment of IgE, high affinity I, receptor for; gamma polypeptide; high affinity immunoglobulin epsilon receptor subunit gamma; fcRgamma; fceRI gamma; fc-epsilon RI-gamma; Fc receptor gamma-chain; immunoglobulin E receptor, high affinity, gamma chain; FCRG |
| Gene ID | 2207 |
| mRNA Refseq | NM_004106 |
| Protein Refseq | NP_004097 |
| MIM | 147139 |
| UniProt ID | P30273 |
| ◆ Recombinant Proteins | ||
| FCER1G-2890H | Recombinant Human FCER1G protein, GST-tagged | +Inquiry |
| FCER1G-3843H | Recombinant Human FCER1G Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| FCER1G-5876Z | Recombinant Zebrafish FCER1G | +Inquiry |
| FCER1G-5499HFL | Recombinant Full Length Human FCER1G, Flag-tagged | +Inquiry |
| RFL11405RF | Recombinant Full Length Rat High Affinity Immunoglobulin Epsilon Receptor Subunit Gamma(Fcer1G) Protein, His-Tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FCER1G-6281HCL | Recombinant Human FCER1G 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FCER1G Products
Required fields are marked with *
My Review for All FCER1G Products
Required fields are marked with *
