Recombinant Full Length Human FCER1G Protein, GST-tagged
Cat.No. : | FCER1G-6927HF |
Product Overview : | Recombinant Human full-length FCER1G(1 a.a. - 86 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 86 amino acids |
Description : | The high affinity IgE receptor is a key molecule involved in allergic reactions. It is a tetramer composed of 1 alpha, 1 beta, and 2 gamma chains. The gamma chains are also subunits of other Fc receptors. |
Molecular Mass : | 36.1 kDa |
AA Sequence : | MIPAVVLLLLLLVEQAAALGEPQLCYILDAILFLYGIVLTLLYCRLKIQVRKAAITSYEKSDGVYTGLSTRNQET YETLKHEKPPQ |
Applications : | ELISA; WB-Re; AP; Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FCER1G Fc epsilon receptor Ig [ Homo sapiens (human) ] |
Official Symbol | FCER1G |
Synonyms | FCER1G; Fc fragment of IgE, high affinity I, receptor for; gamma polypeptide; high affinity immunoglobulin epsilon receptor subunit gamma; fcRgamma; fceRI gamma; fc-epsilon RI-gamma; Fc receptor gamma-chain; immunoglobulin E receptor, high affinity, gamma chain; FCRG |
Gene ID | 2207 |
mRNA Refseq | NM_004106 |
Protein Refseq | NP_004097 |
MIM | 147139 |
UniProt ID | P30273 |
◆ Recombinant Proteins | ||
FCER1G-12816H | Recombinant Human FCER1G, GST-tagged | +Inquiry |
Fcer1g-1026M | Recombinant Mouse Fcer1g Protein, MYC/DDK-tagged | +Inquiry |
FCER1G-197H | Recombinant Human FCER1G, MYC/DDK-tagged | +Inquiry |
FCER1G-2891H | Recombinant Human FCER1G protein, His-B2M-tagged | +Inquiry |
FCER1G-3713C | Recombinant Chicken FCER1G | +Inquiry |
◆ Cell & Tissue Lysates | ||
FCER1G-6281HCL | Recombinant Human FCER1G 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FCER1G Products
Required fields are marked with *
My Review for All FCER1G Products
Required fields are marked with *
0
Inquiry Basket