Recombinant Human FCER1G protein, GST-tagged
Cat.No. : | FCER1G-2890H |
Product Overview : | Recombinant Human FCER1G protein(P30273)(19-86aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 19-86aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 34.8 kDa |
AA Sequence : | LGEPQLCYILDAILFLYGIVLTLLYCRLKIQVRKAAITSYEKSDGVYTGLSTRNQETYETLKHEKPPQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | FCER1G Fc fragment of IgE, high affinity I, receptor for; gamma polypeptide [ Homo sapiens ] |
Official Symbol | FCER1G |
Synonyms | FCER1G; Fc fragment of IgE, high affinity I, receptor for; gamma polypeptide; high affinity immunoglobulin epsilon receptor subunit gamma; fcRgamma; fceRI gamma; fc-epsilon RI-gamma; Fc receptor gamma-chain; immunoglobulin E receptor, high affinity, gamma chain; FCRG; |
Gene ID | 2207 |
mRNA Refseq | NM_004106 |
Protein Refseq | NP_004097 |
MIM | 147139 |
UniProt ID | P30273 |
◆ Recombinant Proteins | ||
FCER1G-6927HF | Recombinant Full Length Human FCER1G Protein, GST-tagged | +Inquiry |
FCER1G-3182M | Recombinant Mouse FCER1G Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL11405RF | Recombinant Full Length Rat High Affinity Immunoglobulin Epsilon Receptor Subunit Gamma(Fcer1G) Protein, His-Tagged | +Inquiry |
FCER1G-5785M | Recombinant Mouse FCER1G Protein | +Inquiry |
FCER1G-3713C | Recombinant Chicken FCER1G | +Inquiry |
◆ Cell & Tissue Lysates | ||
FCER1G-6281HCL | Recombinant Human FCER1G 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FCER1G Products
Required fields are marked with *
My Review for All FCER1G Products
Required fields are marked with *
0
Inquiry Basket