Recombinant Full Length Human FCGR2A Protein, C-Flag-tagged

Cat.No. : FCGR2A-1225HFL
Product Overview : Recombinant Full Length Human FCGR2A Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Mammalian Cells
Tag : Flag
Description : This gene encodes one member of a family of immunoglobulin Fc receptor genes found on the surface of many immune response cells. The protein encoded by this gene is a cell surface receptor found on phagocytic cells such as macrophages and neutrophils, and is involved in the process of phagocytosis and clearing of immune complexes. Alternative splicing results in multiple transcript variants.
Form : 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Molecular Mass : 34.7 kDa
AA Sequence : MTMETQMSQNVCPRNLWLLQPLTVLLLLASADSQAAPPKAVLKLEPPWINVLQEDSVTLTCQGARSPESD SIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIML RCHSWKDKPLVKVTFFQNGKSQKFSRLDPTFSIPQANHSHSGDYHCTGNIGYTLFSSKPVTITVQVPSMG SSSPMGIIVAVVIATAVAAIVAAVVALIYCRKKRISANSTDPVKAAQFEPPGRQMIAIRKRQLEETNNDY
ETADGGYMTLNPRAPTDDDKNIYLTLPPNDHVNSNNTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >50 ug/mL as determined by microplate BCA method.
Preparation : Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Protein Families : ES Cell Differentiation/IPS, Transmembrane
Protein Pathways : Fc gamma R-mediated phagocytosis, Systemic lupus erythematosus
Full Length : Full L.
Gene Name FCGR2A Fc gamma receptor IIa [ Homo sapiens (human) ]
Official Symbol FCGR2A
Synonyms CD32; FCG2; FcGR; CD32A; CDw32; FCGR2; IGFR2; FCGR2A1; FcgammaRIIa
Gene ID 2212
mRNA Refseq NM_021642.5
Protein Refseq NP_067674.2
MIM 146790
UniProt ID P12318

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FCGR2A Products

Required fields are marked with *

My Review for All FCGR2A Products

Required fields are marked with *

0
cart-icon
0
compare icon