Recombinant Full Length Human FCGR3A Protein, GST-tagged

Cat.No. : FCGR3A-4761HF
Product Overview : Human FCGR3A full-length ORF ( AAH17865.1, 17 a.a. - 254 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 17-254 amino acids
Description : This gene encodes a receptor for the Fc portion of immunoglobulin G, and it is involved in the removal of antigen-antibody complexes from the circulation, as well as other other antibody-dependent responses. This gene (FCGR3A) is highly similar to another nearby gene (FCGR3B) located on chromosome 1. The receptor encoded by this gene is expressed on natural killer (NK) cells as an integral membrane glycoprotein anchored through a transmembrane peptide, whereas FCGR3B is expressed on polymorphonuclear neutrophils (PMN) where the receptor is anchored through a phosphatidylinositol (PI) linkage. Mutations in this gene have been linked to susceptibility to recurrent viral infections, susceptibility to systemic lupus erythematosus, and alloimmune neonatal neutropenia. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Molecular Mass : 51.92 kDa
AA Sequence : GMRTEDLPKAVVFLEPQWYRVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAATVDDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKGRKYFHHNSDFYIPKATLKDSGSYFCRGLVGSKNVSSETVNITITQGLAVSTISSFFPPGYQVSFCLVMVLLFAVDTGLYFSVKTNIRSSTRDWKDHKFKWRKDPQDK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FCGR3A Fc fragment of IgG, low affinity IIIa, receptor (CD16a) [ Homo sapiens ]
Official Symbol FCGR3A
Synonyms FCGR3A; Fc fragment of IgG, low affinity IIIa, receptor (CD16a); Fc fragment of IgG, low affinity IIIa, receptor for (CD16) , FCG3, FCGR3; low affinity immunoglobulin gamma Fc region receptor III-A; CD16; CD16a; FcgammaRIIIA; CD16a antigen; fc-gamma RIII; Fc-gamma RIIIa; Fc-gamma RIII-alpha; igG Fc receptor III-2; Fc gamma receptor III-A; Fc-gamma receptor IIIb (CD16); neutrophil-specific antigen NA; Fc-gamma receptor III-2 (CD 16); immunoglobulin G Fc receptor III; Fc fragment of IgG, low affinity III, receptor for (CD16); FCG3; CD16A; FCGR3; IGFR3; FCR-10; FCRIII; FCGRIII; FCRIIIA;
Gene ID 2214
mRNA Refseq NM_000569
Protein Refseq NP_000560
MIM 146740
UniProt ID P08637

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FCGR3A Products

Required fields are marked with *

My Review for All FCGR3A Products

Required fields are marked with *

0
cart-icon