Recombinant Full Length Human FCN1 Protein, GST-tagged

Cat.No. : FCN1-4764HF
Product Overview : Human FCN1 full-length ORF ( NP_001994.2, 1 a.a. - 326 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 326 amino acids
Description : The ficolin family of proteins are characterized by the presence of a leader peptide, a short N-terminal segment, followed by a collagen-like region, and a C-terminal fibrinogen-like domain. The collagen-like and the fibrinogen-like domains are also found separately in other proteins such as complement protein C1q, C-type lectins known as collectins, and tenascins. However, all these proteins recognize different targets, and are functionally distinct. Ficolin 1 encoded by FCN1 is predominantly expressed in the peripheral blood leukocytes, and has been postulated to function as a plasma protein with elastin-binding activity. [provided by RefSeq, Jul 2008]
Molecular Mass : 61.5 kDa
AA Sequence : MELSGATMARGLAVLLVLFLHIKNLPAQAADTCPEVKVVGLEGSDKLTILRGCPGLPGAPGPKGEAGVIGERGERGLPGAPGKAGPVGPKGDRGEKGMRGEKGDAGQSQSCATGPRNCKDLLDRGYFLSGWHTIYLPDCRPLTVLCDMDTDGGGWTVFQRRMDGSVDFYRDWAAYKQGFGSQLGEFWLGNDNIHALTAQGSSELRVDLVDFEGNHQFAKYKSFKVADEAEKYKLVLGAFVGGSAGNSLTGHNNNFFSTKDQDNDVSSSNCAEKFQGAWWYADCHASNLNGLYLMGPHESYANGINWSAAKGYKYSYKVSEMKVRPA
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FCN1 ficolin (collagen/fibrinogen domain containing) 1 [ Homo sapiens ]
Official Symbol FCN1
Synonyms FCN1; ficolin (collagen/fibrinogen domain containing) 1; ficolin-1; FCNM; M-ficolin; ficolin-A; ficolin-alpha; collagen/fibrinogen domain-containing protein 1; ficolin (collagen/fibrinogen domain-containing) 1;
Gene ID 2219
mRNA Refseq NM_002003
Protein Refseq NP_001994
MIM 601252
UniProt ID O00602

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All FCN1 Products

Required fields are marked with *

My Review for All FCN1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon