Recombinant Full Length Human FCN1 Protein, GST-tagged
Cat.No. : | FCN1-4764HF |
Product Overview : | Human FCN1 full-length ORF ( NP_001994.2, 1 a.a. - 326 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 326 amino acids |
Description : | The ficolin family of proteins are characterized by the presence of a leader peptide, a short N-terminal segment, followed by a collagen-like region, and a C-terminal fibrinogen-like domain. The collagen-like and the fibrinogen-like domains are also found separately in other proteins such as complement protein C1q, C-type lectins known as collectins, and tenascins. However, all these proteins recognize different targets, and are functionally distinct. Ficolin 1 encoded by FCN1 is predominantly expressed in the peripheral blood leukocytes, and has been postulated to function as a plasma protein with elastin-binding activity. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 61.5 kDa |
AA Sequence : | MELSGATMARGLAVLLVLFLHIKNLPAQAADTCPEVKVVGLEGSDKLTILRGCPGLPGAPGPKGEAGVIGERGERGLPGAPGKAGPVGPKGDRGEKGMRGEKGDAGQSQSCATGPRNCKDLLDRGYFLSGWHTIYLPDCRPLTVLCDMDTDGGGWTVFQRRMDGSVDFYRDWAAYKQGFGSQLGEFWLGNDNIHALTAQGSSELRVDLVDFEGNHQFAKYKSFKVADEAEKYKLVLGAFVGGSAGNSLTGHNNNFFSTKDQDNDVSSSNCAEKFQGAWWYADCHASNLNGLYLMGPHESYANGINWSAAKGYKYSYKVSEMKVRPA |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FCN1 ficolin (collagen/fibrinogen domain containing) 1 [ Homo sapiens ] |
Official Symbol | FCN1 |
Synonyms | FCN1; ficolin (collagen/fibrinogen domain containing) 1; ficolin-1; FCNM; M-ficolin; ficolin-A; ficolin-alpha; collagen/fibrinogen domain-containing protein 1; ficolin (collagen/fibrinogen domain-containing) 1; |
Gene ID | 2219 |
mRNA Refseq | NM_002003 |
Protein Refseq | NP_001994 |
MIM | 601252 |
UniProt ID | O00602 |
◆ Recombinant Proteins | ||
FCN1-703H | Active Recombinant Human FCN1, His tagged | +Inquiry |
FCN1-377R | Recombinant Rhesus FCN1 Protein, Fc-tagged | +Inquiry |
FCN1-6728H | Recombinant Human FCN1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
FCN1-4001H | Recombinant Human FCN1 Protein, GST-tagged | +Inquiry |
FCN1-3016H | Recombinant Human FCN1 Protein (Ala30-Ala326), His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FCN1-2748HCL | Recombinant Human FCN1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FCN1 Products
Required fields are marked with *
My Review for All FCN1 Products
Required fields are marked with *
0
Inquiry Basket