Recombinant Human FCN1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | FCN1-6728H |
Product Overview : | FCN1 MS Standard C13 and N15-labeled recombinant protein (NP_001994) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The ficolin family of proteins are characterized by the presence of a leader peptide, a short N-terminal segment, followed by a collagen-like region, and a C-terminal fibrinogen-like domain. The collagen-like and the fibrinogen-like domains are also found separately in other proteins such as complement protein C1q, C-type lectins known as collectins, and tenascins. However, all these proteins recognize different targets, and are functionally distinct. Ficolin 1 encoded by FCN1 is predominantly expressed in the peripheral blood leukocytes, and has been postulated to function as a plasma protein with elastin-binding activity. |
Molecular Mass : | 35.1 kDa |
AA Sequence : | MELSGATMARGLAVLLVLFLHIKNLPAQAADTCPEVKVVGLEGSDKLTILRGCPGLPGAPGPKGEAGVIGERGERGLPGAPGKAGPVGPKGDRGEKGMRGEKGDAGQSQSCATGPRNCKDLLDRGYFLSGWHTIYLPDCRPLTVLCDMDTDGGGWTVFQRRMDGSVDFYRDWAAYKQGFGSQLGEFWLGNDNIHALTAQGSSELRVDLVDFEGNHQFAKYKSFKVADEAEKYKLVLGAFVGGSAGNSLTGHNNNFFSTKDQDNDVSSSNCAEKFQGAWWYADCHASNLNGLYLMGPHESYANGINWSAAKGYKYSYKVSEMKVRPATRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | FCN1 ficolin 1 [ Homo sapiens (human) ] |
Official Symbol | FCN1 |
Synonyms | FCN1; ficolin (collagen/fibrinogen domain containing) 1; ficolin-1; FCNM; M-ficolin; ficolin-A; ficolin-alpha; collagen/fibrinogen domain-containing protein 1; ficolin (collagen/fibrinogen domain-containing) 1; |
Gene ID | 2219 |
mRNA Refseq | NM_002003 |
Protein Refseq | NP_001994 |
MIM | 601252 |
UniProt ID | O00602 |
◆ Recombinant Proteins | ||
FCN1-4764HF | Recombinant Full Length Human FCN1 Protein, GST-tagged | +Inquiry |
FCN1-1474H | Recombinant Human FCN1 Protein, His-tagged | +Inquiry |
FCN1-3016H | Recombinant Human FCN1 Protein (Ala30-Ala326), His tagged | +Inquiry |
FCN1-703H | Active Recombinant Human FCN1, His tagged | +Inquiry |
FCN1-4001H | Recombinant Human FCN1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FCN1-2748HCL | Recombinant Human FCN1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FCN1 Products
Required fields are marked with *
My Review for All FCN1 Products
Required fields are marked with *
0
Inquiry Basket