Recombinant Full Length Human FCN3 Protein, GST-tagged
| Cat.No. : | FCN3-4766HF |
| Product Overview : | Human FCN3 full-length ORF ( AAH20731, 1 a.a. - 288 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 288 amino acids |
| Description : | Ficolins are a group of proteins which consist of a collagen-like domain and a fibrinogen-like domain. In human serum, there are two types of ficolins, both of which have lectin activity. The protein encoded by this gene is a thermolabile beta-2-macroglycoprotein found in all human serum and is a member of the ficolin/opsonin p35 lectin family. The protein, which was initially identified based on its reactivity with sera from patients with systemic lupus erythematosus, has been shown to have a calcium-independent lectin activity. The protein can activate the complement pathway in association with MASPs and sMAP, thereby aiding in host defense through the activation of the lectin pathway. Alternative splicing occurs at this locus and two variants, each encoding a distinct isoform, have been identified. [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 57.42 kDa |
| AA Sequence : | MDLLWILPSLWLLLLGGPACLKTQEHPSCPGPRELEASKVVLLPSCPGAPGSPGEKGAPGPQGPPGPPGKMGPKGEPGPRNCRELLSQGATLSGWYHLCLPEGRALPVFCDMDTEGGGWLVFQRRQDGSVDFFRSWSSYRAGFGNQESEFWLGNENLHQLTLQGNWELRVELEDFNGNRTFAHYATFRLLGEVDHYQLALGKFSEGTAGDSLSLHSGRPLTTYDADHDSSNSNCAVIVHGAWWYASCYRSNLNGRYAVSEAAAHKYGIDWASGRGVGHPYRRVRMMLR |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | FCN3 ficolin (collagen/fibrinogen domain containing) 3 (Hakata antigen) [ Homo sapiens ] |
| Official Symbol | FCN3 |
| Synonyms | FCN3; ficolin (collagen/fibrinogen domain containing) 3 (Hakata antigen); ficolin-3; FCNH; HAKA1; H-ficolin; ficolin 3; collagen/fibrinogen domain-containing protein 3; collagen/fibrinogen domain-containing lectin 3 p35; MGC22543; |
| Gene ID | 8547 |
| mRNA Refseq | NM_003665 |
| Protein Refseq | NP_003656 |
| MIM | 604973 |
| UniProt ID | O75636 |
| ◆ Recombinant Proteins | ||
| FCN3-2893H | Recombinant Human FCN3 protein, His-tagged | +Inquiry |
| FCN3-2937H | Recombinant Human FCN3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| FCN3-4004H | Recombinant Human FCN3 Protein, GST-tagged | +Inquiry |
| FCN3-12827H | Recombinant Human FCN3, GST-tagged | +Inquiry |
| FCN3-854H | Active Recombinant Human FCN3 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FCN3-614HCL | Recombinant Human FCN3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FCN3 Products
Required fields are marked with *
My Review for All FCN3 Products
Required fields are marked with *
