Recombinant Full Length Human FDFT1 Protein, C-Flag-tagged

Cat.No. : FDFT1-1048HFL
Product Overview : Recombinant Full Length Human FDFT1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Mammalian Cells
Tag : Flag
Description : This gene encodes a membrane-associated enzyme located at a branch point in the mevalonate pathway. The encoded protein is the first specific enzyme in cholesterol biosynthesis, catalyzing the dimerization of two molecules of farnesyl diphosphate in a two-step reaction to form squalene.
Form : 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Molecular Mass : 47.9 kDa
AA Sequence : MEFVKCLGHPEEFYNLVRFRIGGKRKVMPKMDQDSLSSSLKTCYRYLNQTSRSFAAVIQALDGEMRNAVC IFYLVLRALDTLEDDMTISVEKKVPLLHNFHSFLYQPDWRFMESKEKDRQVLEDFPTISLEFRNLAEKYQ TVIADICRRMGIGMAEFLDKHVTSEQEWDKYCHYVAGLVGIGLSRLFSASEFEDPLVGEDTERANSMGLF LQKTNIIRDYLEDQQGGREFWPQEVWSRYVKKLGDFAKPENIDLAVQCLNELITNALHHIPDVITYLSRL RNQSVFNFCAIPQVMAIATLAACYNNQQVFKGAVKIRKGQAVTLMMDATNMPAVKAIIYQYMEEIYHRIP DSDPSSSKTRQIISTIRTQNLPNCQLISRSHYSPIYLSFVMLLAALSWQYLTTLSQVTEDYVQTGEHTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >50 ug/mL as determined by microplate BCA method.
Preparation : Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Protein Families : Druggable Genome
Protein Pathways : Metabolic pathways, Steroid biosynthesis
Full Length : Full L.
Gene Name FDFT1 farnesyl-diphosphate farnesyltransferase 1 [ Homo sapiens (human) ]
Official Symbol FDFT1
Synonyms SS; SQS; DGPT; ERG9; SQSD
Gene ID 2222
mRNA Refseq NM_004462.5
Protein Refseq NP_004453.3
MIM 184420
UniProt ID P37268

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FDFT1 Products

Required fields are marked with *

My Review for All FDFT1 Products

Required fields are marked with *

0
cart-icon