Recombinant Full Length Human FGFR1OP Protein, GST-tagged
Cat.No. : | FGFR1OP-4887HF |
Product Overview : | Human FGFR1OP full-length ORF ( AAH11902, 1 a.a. - 379 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 379 amino acids |
Description : | This gene encodes a largely hydrophilic protein postulated to be a leucine-rich protein family member. A t(6;8)(q27;p11) chromosomal translocation, fusing this gene and the fibroblast growth factor receptor 1 (FGFR1) gene, has been found in cases of myeloproliferative disorder. The resulting chimeric protein contains the N-terminal leucine-rich region of this encoded protein fused to the catalytic domain of FGFR1. This gene is thought to play an important role in normal proliferation and differentiation of the erythroid lineage. Alternatively spliced transcript variants that encode different proteins have been identified. [provided by RefSeq |
Molecular Mass : | 67.43 kDa |
AA Sequence : | MAATAAAVVAEEDTELRDLLVQTLENSGVLNRIKAELRAAVFLALEEQEKVENKTPLVNESLRKFLNTKDGRLVASLVAEFLQFFNLDFTLAVFQPETSTLQGLEGRENLARDLGIIEAEGTVGGPLLLEVIRRCQQKEKGPTTGEGALDLSDVHSPPKSPEGKTSAQTTPSKKANDEANQSDTSVSLSEPKSKSSLHLLSHETKIGSFLSNRTLDGKDKAGLCPDEDDMEGDSFFDDPIPKPEKTYGLRNEPRKQAGSLASLSDAPPLKSGLSSLAGAPSLKDSESKRGNTVLKDLKLISDKIGSLGLGTGEDDDYVDDFNSTSHRSEKSEISIGEEIEEDLSVEIDDINTSDKLDDLTQDLTVSQLSDVADYLEDVA |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FGFR1OP FGFR1 oncogene partner [ Homo sapiens ] |
Official Symbol | FGFR1OP |
Synonyms | FGFR1OP; FGFR1 oncogene partner; FOP; fibroblast growth factor receptor 1 oncogene partner; |
Gene ID | 11116 |
mRNA Refseq | NM_007045 |
Protein Refseq | NP_008976 |
MIM | 605392 |
UniProt ID | O95684 |
◆ Recombinant Proteins | ||
FGFR1OP-12879H | Recombinant Human FGFR1OP, GST-tagged | +Inquiry |
FGFR1OP-1320H | Recombinant Human FGFR1OP protein(Ala2-Ala379), His&GST-tagged | +Inquiry |
FGFR1OP-524C | Recombinant Cynomolgus FGFR1OP Protein, His-tagged | +Inquiry |
FGFR1OP-496H | Recombinant Human FGFR1OP, His-GST tagged | +Inquiry |
FGFR1OP-5861M | Recombinant Mouse FGFR1OP Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
FGFR1OP-001HCL | Recombinant Human FGFR1OP cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FGFR1OP Products
Required fields are marked with *
My Review for All FGFR1OP Products
Required fields are marked with *