Recombinant Full Length Human FGL2 Protein, GST-tagged
| Cat.No. : | FGL2-4944HF |
| Product Overview : | Human FGL2 full-length ORF ( NP_006673.1, 1 a.a. - 439 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 439 amino acids |
| Description : | The protein encoded by this gene is a secreted protein that is similar to the beta- and gamma-chains of fibrinogen. The carboxyl-terminus of the encoded protein consists of the fibrinogen-related domains (FRED). The encoded protein forms a tetrameric complex which is stabilized by interchain disulfide bonds. This protein may play a role in physiologic functions at mucosal sites. [provided by RefSeq |
| Molecular Mass : | 76.6 kDa |
| AA Sequence : | MKLANWYWLSSAVLATYGFLVVANNETEEIKDERAKDVCPVRLESRGKCEEAGECPYQVSLPPLTIQLPKQFSRIEEVFKEVQNLKEIVNSLKKSCQDCKLQADDNGDPGRNGLLLPSTGAPGEVGDNRVRELESEVNKLSSELKNAKEEINVLHGRLEKLNLVNMNNIENYVDSKVANLTFVVNSLDGKCSKCPSQEQIQSRPVQHLIYKDCSDYYAIGKRSSETYRVTPDPKNSSFEVYCDMETMGGGWTVLQARLDGSTNFTRTWQDYKAGFGNLRREFWLGNDKIHLLTKSKEMILRIDLEDFNGVELYALYDQFYVANEFLKYRLHVGNYNGTAGDALRFNKHYNHDLKFFTTPDKDNDRYPSGNCGLYYSSGWWFDACLSANLNGKYYHQKYRGVRNGIFWGTWPGVSEAHPGGYKSSFKEAKMMIRPKHFKP |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | FGL2 fibrinogen-like 2 [ Homo sapiens ] |
| Official Symbol | FGL2 |
| Synonyms | FGL2; fibrinogen-like 2; fibroleukin; pT49; T49; fibrinogen-like protein 2; |
| Gene ID | 10875 |
| mRNA Refseq | NM_006682 |
| Protein Refseq | NP_006673 |
| MIM | 605351 |
| UniProt ID | Q14314 |
| ◆ Recombinant Proteins | ||
| FGL2-298HFL | Recombinant Full Length Human FGL2 Protein, C-Flag-tagged | +Inquiry |
| Fgl2-001M | Active Recombinant Mouse Fgl2 Protein, His-tagged | +Inquiry |
| FGL2-1360C | Recombinant Cynomolgus FGL2 protein, His-Avi,Flag-tagged | +Inquiry |
| FGL2-3525C | Recombinant Chicken FGL2 | +Inquiry |
| FGL2-749H | Recombinant Human FGL2 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FGL2-622HCL | Recombinant Human FGL2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FGL2 Products
Required fields are marked with *
My Review for All FGL2 Products
Required fields are marked with *
