Recombinant Full Length Human FKBP11 Protein, GST-tagged

Cat.No. : FKBP11-4791HF
Product Overview : Human FKBP11 full-length ORF ( NP_057678.1, 1 a.a. - 201 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 201 amino acids
Description : FKBP11 belongs to the FKBP family of peptidyl-prolyl cis/trans isomerases, which catalyze the folding of proline-containing polypeptides. The peptidyl-prolyl isomerase activity of FKBP proteins is inhibited by the immunosuppressant compounds FK506 and rapamycin (Rulten et al., 2006 [PubMed 16596453]).[supplied by OMIM
Molecular Mass : 48.6 kDa
AA Sequence : MTLRPSLLPLHLLLLLLLSAAVCRAEAGLETESPVRTLQVETLVEPPEPCAEPAAFGDTLHIHYTGSLVDGRIIDTSLTRDPLVIELGQKQVIPGLEQSLLDMCVGEKRRAIIPSHLAYGKRGFPPSVPADAVVQYDVELIALIRANYWLKLVKGILPLVGMAMVPALLGLIGYHLYRKANRPKVSKKKLKEEKRNKSKKK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FKBP11 FK506 binding protein 11, 19 kDa [ Homo sapiens ]
Official Symbol FKBP11
Synonyms FKBP11; FK506 binding protein 11, 19 kDa; FK506 binding protein 11 (19 kDa); peptidyl-prolyl cis-trans isomerase FKBP11; FKBP19; FKBP-11; FKBP-19; rotamase; 19 kDa FKBP; PPIase FKBP11; FK506-binding protein 11; 19 kDa FK506-binding protein; MGC54182;
Gene ID 51303
mRNA Refseq NM_001143781
Protein Refseq NP_001137253
MIM 610571
UniProt ID Q9NYL4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FKBP11 Products

Required fields are marked with *

My Review for All FKBP11 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon