Recombinant Full Length Human FMO1 Protein, GST-tagged

• Cat.No.: FMO1-6934HF
• Product Overview: Recombinant Human full-length FMO1(1 aa. - 532 aa), fused with aN-terminal GST tag, was expressed in Wheat germ.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 532 amino acids
• Description: Metabolic N-oxidation of the diet-derived amino-trimethylamine (TMA) is mediated by flavin-containing monooxygenase and is subject to an inherited FMO3 polymorphism in man resulting in a small subpopulation with reduced TMA N-oxidation capacity resulting in fish odor syndrome Trimethylaminuria. Three forms of the enzyme, FMO1 found in fetal liver, FMO2 found in adult liver, and FMO3 are encoded by genes clustered in the 1q23-q25 region. Flavin-containing monooxygenases are NADPH-dependent flavoenzymes that catalyzes the oxidation of soft nucleophilic heteroatom centers in drugs, pesticides, and xenobiotics.
• Molecular Mass: 84.26kDa
• AA Sequence: MAKRVAIVGAGVSGLASIKCCLEEGLEPTCFERSDDLGGLWRFTEHVEEGRASLYKSVVSNSCKEMSCYSDFPFPEDYPNYVPNSQFLEYLKMYANHFDLLKHIQFKTKVCSVTKCSDSAVSGQWEVVTMHEEKQESAIFDAVMVCTGFLTNPYLPLDSFPGINAFKGQYFHSRQYKHPDIFKDKRVLVIGMGNSGTDIAVEASHLAEKVFLSTTGGGWVISRIFDSGYPWDMVFMTRFQNMLRNSLPTPIVTWLMERKINNWLNHANYGLIPEDRTQLKEFVLNDELPGRIITGKVFIRPSIKEVKENSVIFNNTSKEEPIDIIVFATGYTFAFPFLDESVVKVEDGQASLYKYIFPAHLQKPTLAIIGLIKPLGSMIPTGETQARWAVRVLKGVNKLPPPSVMIEEINARKENKPSWFGLCYCKALQSDYITYIDELLTYINAKPNLFSMLLTDPHLALTVFFGPCSPYQFRLTGPGKWEGARNAIMTQWDRTFKVIKARVVQESPSPFESFLKVFSFLALLVAIFLIFL
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FMO1 flavin containing monooxygenase 1 [ Homo sapiens ]
• Official Symbol: FMO1
• Synonyms: flavin containing monooxygenase 1; FMO1; dimethylanilinemonooxygenase [N-oxide-forming] 1; FMO 1; OTTHUMP00000033537; dimethylaniline oxidase 1; Flavin-containing monooxygenase 1 (fetal liver); fetal hepatic flavin-containing monooxygenase 1; Dimethylaniline oxidase 1; Fetal hepatic flavin-containing monooxygenase 1; EC 1.14.13.8
• Gene ID: 2326
• mRNA Refseq: NM_002021
• Protein Refseq: NP_002012
• MIM: 136130
• UniProt ID: Q01740