Recombinant Full Length Human FMO1 Protein, GST-tagged

Cat.No. : FMO1-6934HF
Product Overview : Recombinant Human full-length FMO1(1 aa. - 532 aa), fused with aN-terminal GST tag, was expressed in Wheat germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 532 amino acids
Description : Metabolic N-oxidation of the diet-derived amino-trimethylamine (TMA) is mediated by flavin-containing monooxygenase and is subject to an inherited FMO3 polymorphism in man resulting in a small subpopulation with reduced TMA N-oxidation capacity resulting in fish odor syndrome Trimethylaminuria. Three forms of the enzyme, FMO1 found in fetal liver, FMO2 found in adult liver, and FMO3 are encoded by genes clustered in the 1q23-q25 region. Flavin-containing monooxygenases are NADPH-dependent flavoenzymes that catalyzes the oxidation of soft nucleophilic heteroatom centers in drugs, pesticides, and xenobiotics.
Molecular Mass : 84.26kDa
AA Sequence : MAKRVAIVGAGVSGLASIKCCLEEGLEPTCFERSDDLGGLWRFTEHVEEGRASLYKSVVSNSCKEMSCYSDFPFPEDYPNYVPNSQFLEYLKMYANHFDLLKHIQFKTKVCSVTKCSDSAVSGQWEVVTMHEEKQESAIFDAVMVCTGFLTNPYLPLDSFPGINAFKGQYFHSRQYKHPDIFKDKRVLVIGMGNSGTDIAVEASHLAEKVFLSTTGGGWVISRIFDSGYPWDMVFMTRFQNMLRNSLPTPIVTWLMERKINNWLNHANYGLIPEDRTQLKEFVLNDELPGRIITGKVFIRPSIKEVKENSVIFNNTSKEEPIDIIVFATGYTFAFPFLDESVVKVEDGQASLYKYIFPAHLQKPTLAIIGLIKPLGSMIPTGETQARWAVRVLKGVNKLPPPSVMIEEINARKENKPSWFGLCYCKALQSDYITYIDELLTYINAKPNLFSMLLTDPHLALTVFFGPCSPYQFRLTGPGKWEGARNAIMTQWDRTFKVIKARVVQESPSPFESFLKVFSFLALLVAIFLIFL
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FMO1 flavin containing monooxygenase 1 [ Homo sapiens ]
Official Symbol FMO1
Synonyms flavin containing monooxygenase 1; FMO1; dimethylanilinemonooxygenase [N-oxide-forming] 1; FMO 1; OTTHUMP00000033537; dimethylaniline oxidase 1; Flavin-containing monooxygenase 1 (fetal liver); fetal hepatic flavin-containing monooxygenase 1; Dimethylaniline oxidase 1; Fetal hepatic flavin-containing monooxygenase 1; EC 1.14.13.8
Gene ID 2326
mRNA Refseq NM_002021
Protein Refseq NP_002012
MIM 136130
UniProt ID Q01740

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FMO1 Products

Required fields are marked with *

My Review for All FMO1 Products

Required fields are marked with *

0
cart-icon
0
compare icon