Recombinant Full Length Human FNDC4 Protein, C-Flag-tagged
Cat.No. : | FNDC4-1094HFL |
Product Overview : | Recombinant Full Length Human FNDC4 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Involved in response to transforming growth factor beta. Predicted to be located in endoplasmic reticulum and extracellular space. Predicted to be active in extracellular region and plasma membrane. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 25 kDa |
AA Sequence : | MPSGCHSSPPSGLRGDMASLVPLSPYLSPTVLLLVSCDLGFVRADRPPSPVNVTVTHLRANSATVSWDVP EGNIVIGYSISQQRQNGPGQRVIREVNTTTRACALWGLAEDSDYTVQVRSIGLRGESPPGPRVHFRTLKG SDRLPSNSSSPGDITVEGLDGERPLQTGEVVIIVVVLLMWAAVIGLFCRQYDIIKDNDSNNNPKEKGKGP EQSPQGRPVGTRQKKSPSINTIDVTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Transmembrane |
Full Length : | Full L. |
Gene Name | FNDC4 fibronectin type III domain containing 4 [ Homo sapiens (human) ] |
Official Symbol | FNDC4 |
Synonyms | FRCP1 |
Gene ID | 64838 |
mRNA Refseq | NM_022823.3 |
Protein Refseq | NP_073734.1 |
MIM | 611905 |
UniProt ID | Q9H6D8 |
◆ Recombinant Proteins | ||
FNDC4-4408H | Recombinant Human FNDC4 Protein, GST-tagged | +Inquiry |
FNDC4-685H | Recombinant Human FNDC4 Protein, Fc-tagged | +Inquiry |
FNDC4-1094HFL | Recombinant Full Length Human FNDC4 Protein, C-Flag-tagged | +Inquiry |
FNDC4-4330H | Recombinant Human FNDC4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
FNDC4-929H | Recombinant Human FNDC4 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FNDC4-6173HCL | Recombinant Human FNDC4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FNDC4 Products
Required fields are marked with *
My Review for All FNDC4 Products
Required fields are marked with *
0
Inquiry Basket