Recombinant Full Length Human FNDC7 Protein, GST-tagged

Cat.No. : FNDC7-5010HF
Product Overview : Human FNDC7 full-length ORF (BAC04077.1, 1 a.a. - 500 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 500 amino acids
Description : FNDC7 (Fibronectin Type III Domain Containing 7) is a Protein Coding gene.
Molecular Mass : 80 kDa
AA Sequence : MALSDSSELTCSTTFSSCTISSLQCGTEYLISVLASNDAGSSKSSSAMTLKTVACAPGRVTIQEDPPGHLSVAWSNVDPGDYYVVFVKSDDGLEVHCNTSLTQCNFLSECGFTYFISVFAYNKAGQSPLGDIFNYTTAPCCPSDINPVLVSSDRVEIVWSPVRGAELYETKAVDGYNMVECNDTTPACTLSALECDTKYNITVYSFNEVRGSNMSCTPQFITTAPCSPEIKNVSRDAFSMINVHWRSTNDDATYTVTAQGEKGLYQCSSTGESCTMRGLPCGSVFSVTAVAETQAGRSLPSYSVPLETVPCCPTGLTVTQITQSVINVSWTIGRVAQTHVAVLESHTGQSKCHTHQNHCLLGCITCGINYTVTLKAISATGLTADCSYQSYFSGACCPLGVKLYRLGPNGIRIYWQASRGSANYSTDLYGSKGIFTCTPSAGLSFCDVTEIPCGDVYTVMVSPVAKTGLKLTFCPKKIYSVTCSGSTLGMVIYRGKRNEE
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FNDC7 fibronectin type III domain containing 7 [ Homo sapiens ]
Official Symbol FNDC7
Synonyms RP11-293A10.2; FNDC7; fibronectin type III domain containing 7; Fibronectin Type III Domain Containing 7
Gene ID 163479
mRNA Refseq NM_001144937
Protein Refseq NP_001138409
UniProt ID Q5VTL7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FNDC7 Products

Required fields are marked with *

My Review for All FNDC7 Products

Required fields are marked with *

0
cart-icon