Recombinant Human FNDC7 Protein, GST-tagged
| Cat.No. : | FNDC7-4412H |
| Product Overview : | Human FNDC7 full-length ORF (BAC04077.1, 1 a.a. - 500 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | FNDC7 (Fibronectin Type III Domain Containing 7) is a Protein Coding gene. |
| Molecular Mass : | 80 kDa |
| AA Sequence : | MALSDSSELTCSTTFSSCTISSLQCGTEYLISVLASNDAGSSKSSSAMTLKTVACAPGRVTIQEDPPGHLSVAWSNVDPGDYYVVFVKSDDGLEVHCNTSLTQCNFLSECGFTYFISVFAYNKAGQSPLGDIFNYTTAPCCPSDINPVLVSSDRVEIVWSPVRGAELYETKAVDGYNMVECNDTTPACTLSALECDTKYNITVYSFNEVRGSNMSCTPQFITTAPCSPEIKNVSRDAFSMINVHWRSTNDDATYTVTAQGEKGLYQCSSTGESCTMRGLPCGSVFSVTAVAETQAGRSLPSYSVPLETVPCCPTGLTVTQITQSVINVSWTIGRVAQTHVAVLESHTGQSKCHTHQNHCLLGCITCGINYTVTLKAISATGLTADCSYQSYFSGACCPLGVKLYRLGPNGIRIYWQASRGSANYSTDLYGSKGIFTCTPSAGLSFCDVTEIPCGDVYTVMVSPVAKTGLKLTFCPKKIYSVTCSGSTLGMVIYRGKRNEE |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | FNDC7 fibronectin type III domain containing 7 [ Homo sapiens ] |
| Official Symbol | FNDC7 |
| Synonyms | RP11-293A10.2; FNDC7; fibronectin type III domain containing 7; Fibronectin Type III Domain Containing 7 |
| Gene ID | 163479 |
| mRNA Refseq | NM_001144937 |
| Protein Refseq | NP_001138409 |
| UniProt ID | Q5VTL7 |
| ◆ Recombinant Proteins | ||
| FNDC7-5959M | Recombinant Mouse FNDC7 Protein | +Inquiry |
| FNDC7-3303M | Recombinant Mouse FNDC7 Protein, His (Fc)-Avi-tagged | +Inquiry |
| FNDC7-4412H | Recombinant Human FNDC7 Protein, GST-tagged | +Inquiry |
| FNDC7-5010HF | Recombinant Full Length Human FNDC7 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FNDC7 Products
Required fields are marked with *
My Review for All FNDC7 Products
Required fields are marked with *
